KEGG   Myotis brandtii (Brandt's bat): 102243544Help
Entry
102243544         CDS       T02920                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb05164  Influenza A
myb05202  Transcriptional misregulation in cancer
myb05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:myb00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    102243544 (TMPRSS2)
  09162 Cancers: Specific types
   05215 Prostate cancer
    102243544 (TMPRSS2)
  09172 Infectious diseases: Viral
   05164 Influenza A
    102243544 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:myb01002]
    102243544 (TMPRSS2)
Enzymes [BR:myb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102243544 (TMPRSS2)
Peptidases [BR:myb01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102243544 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 DUF1986 Hepsin-SRCR SRCR Ldl_recept_a Trypsin_2
Motif
Other DBs
NCBI-GeneID: 102243544
NCBI-ProteinID: XP_005885757
LinkDB All DBs
Position
Un
AA seq 492 aa AA seqDB search
MALNSGLPPGVGPYYENHGYQPENLYPPRPSVDPSAYVVYPAPYYPPTVPQYAPRVLTNT
STPAVRTQPKSPSRTLCTSKTKKVLCITVALVAVLAGAVAAALLLWKFTENRCTVSGMEC
GSSGTCVSASLWCDGILHCPSGEDENQCVRLYGPNFILQVYSSQRKSWHPVCRDDWSESY
GRAACQDMGYRNSFYSSQGIVDDSGATSFLKLNISAGNTDLYKKLYHSDVCSSKTVVSLR
CIECGVNSKMGRQSRIVGGSSAAPGDWPWQVSLHVQGVHVCGGSIITPEWIVTAAHCVEE
PLNNPRYWMAFAGILRQSAMFYGNAYRVGKVISHPHYDSKTKNNDIALMKLQTPLTFNDK
VKPVCLPNPGLMLEPRQACWISGWGATYEKGKTSDMLNAAMVPLIEPGQCNGRYVYNNLV
TPTMVCAGYLRGSVDSCQGDSGGPLVTLKNSIWWLIGDTSWGSGCAKANRPGVYGNVTMF
TDWIYRQMKANS
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcgttaaactcaggattaccaccaggtgttgggccttactacgaaaaccatgggtac
cagcccgaaaacctgtacccgccgcggccctctgtggaccccagtgcctacgtggtgtat
ccagctccctactacccgcccacggtgccccagtacgcccccagggttctgacgaacacc
tcgacacctgccgtccgcacgcagcccaagtccccatcgaggacactgtgcacctcaaag
acgaagaaagtgctgtgcatcaccgtggccctggtggccgtgctcgccggggcagtggcg
gccgctctcctgctctggaagttcacggagaacaggtgcacggtgtcggggatggagtgt
ggctcctcggggacctgtgtcagcgcctctctctggtgtgacgggatcctgcactgtccc
agcggggaggacgagaaccagtgcgtgcgtctctacggacccaacttcatcctgcaggtg
tactcgtcccagaggaagtcctggcaccctgtgtgccgagacgactggagcgagagctac
gggagggcagcgtgccaggacatgggctacaggaatagtttttattccagccaaggaata
gtggatgacagcggggccaccagcttcctgaagctgaacatcagtgccggcaacaccgac
ctctataaaaagctctaccacagtgatgtctgttcttcaaaaacagtggtttctttacgc
tgtatagagtgcggggtcaactcgaagatgggccgccagagtcggatcgtgggcggatcg
agtgctgccccgggggactggccctggcaggtcagcctgcacgtccaaggcgtccacgtc
tgtggcggctccattatcacccccgagtggatcgtgacggccgctcactgcgtggaagag
cctctgaacaatccccggtactggatggcctttgcaggaatcttgagacaatccgccatg
ttctacggaaacgcgtaccgagtgggcaaggtgatttctcatccgcactatgattccaag
accaagaacaatgacatcgctcttatgaagctgcagacgccgctgacttttaacgacaaa
gtgaaaccggtgtgtctgcccaacccaggcctgatgctggagccgagacaggcctgctgg
atctccgggtggggggccacctacgagaaagggaaaacgtcggacatgctgaacgccgcg
atggtgcccctcatcgagcccgggcagtgtaacggcagatacgtctacaacaacctggtc
acgcccaccatggtctgcgccgggtacctgcggggcagcgtggattcctgccagggcgac
agtggcggccctctggtcacgttgaagaacagcatctggtggctgattggggacacgagc
tgggggtccggctgcgccaaggcgaacaggccaggagtgtacggaaacgtgacgatgttt
acagactggatctatcgacaaatgaaggccaacagctga

DBGET integrated database retrieval system