KEGG   Myotis brandtii (Brandt's bat): 102243627
Entry
102243627         CDS       T02920                                 

Gene name
IL4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04060  Cytokine-cytokine receptor interaction
myb04151  PI3K-Akt signaling pathway
myb04630  JAK-STAT signaling pathway
myb04640  Hematopoietic cell lineage
myb04657  IL-17 signaling pathway
myb04658  Th1 and Th2 cell differentiation
myb04659  Th17 cell differentiation
myb04660  T cell receptor signaling pathway
myb04664  Fc epsilon RI signaling pathway
myb04672  Intestinal immune network for IgA production
myb05140  Leishmaniasis
myb05200  Pathways in cancer
myb05310  Asthma
myb05320  Autoimmune thyroid disease
myb05321  Inflammatory bowel disease
myb05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102243627 (IL4)
   04151 PI3K-Akt signaling pathway
    102243627 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102243627 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102243627 (IL4)
   04660 T cell receptor signaling pathway
    102243627 (IL4)
   04658 Th1 and Th2 cell differentiation
    102243627 (IL4)
   04659 Th17 cell differentiation
    102243627 (IL4)
   04657 IL-17 signaling pathway
    102243627 (IL4)
   04664 Fc epsilon RI signaling pathway
    102243627 (IL4)
   04672 Intestinal immune network for IgA production
    102243627 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102243627 (IL4)
  09163 Immune disease
   05310 Asthma
    102243627 (IL4)
   05320 Autoimmune thyroid disease
    102243627 (IL4)
   05321 Inflammatory bowel disease
    102243627 (IL4)
   05330 Allograft rejection
    102243627 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102243627 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:myb04052]
    102243627 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:myb00536]
    102243627 (IL4)
Cytokines and growth factors [BR:myb04052]
 Cytokines
  Interleukins
   102243627 (IL4)
Glycosaminoglycan binding proteins [BR:myb00536]
 Heparan sulfate / Haparin
  Cytokines
   102243627 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 102243627
NCBI-ProteinID: XP_005865684
LinkDB
Position
Un
AA seq 139 aa
MGLTSQLIPALICLLACTSDFTHGRKYNTLQETIKMLNVLTAKKDPRCMELTVSDVLAAP
KNTTEKETLCRAATVLRQVYRHHKCLTKILSGLDRNLSSMANKTSCPVNEAKKRTLKDFL
ERLKTIMQEKYSKGGSWIF
NT seq 420 nt   +upstreamnt  +downstreamnt
atgggtctcacatcccaactgattccagctctgatctgcttactagcatgtaccagcgac
ttcacccacggacgcaagtacaacaccttacaagagaccatcaaaatgctgaacgtcctc
acagcgaaaaaggatccacggtgcatggagctgaccgtatcagacgtcttggctgcccca
aagaacacaactgagaaggaaaccttgtgcagggccgcgacggtgcttcggcaggtctac
aggcaccacaagtgcttgaccaaaatattgagcggacttgacaggaacctcagcagcatg
gccaacaagacctcctgtcctgtgaacgaagccaagaagaggacactgaaagacttcttg
gaaaggttaaagaccatcatgcaagagaaatactcaaagggtggaagctggatattttaa

DBGET integrated database retrieval system