KEGG   Myotis brandtii (Brandt's bat): 102245891
Entry
102245891         CDS       T02920                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb01522  Endocrine resistance
myb01524  Platinum drug resistance
myb04012  ErbB signaling pathway
myb04066  HIF-1 signaling pathway
myb04068  FoxO signaling pathway
myb04110  Cell cycle
myb04115  p53 signaling pathway
myb04151  PI3K-Akt signaling pathway
myb04218  Cellular senescence
myb04630  JAK-STAT signaling pathway
myb04921  Oxytocin signaling pathway
myb04928  Parathyroid hormone synthesis, secretion and action
myb04934  Cushing syndrome
myb05160  Hepatitis C
myb05161  Hepatitis B
myb05163  Human cytomegalovirus infection
myb05165  Human papillomavirus infection
myb05166  Human T-cell leukemia virus 1 infection
myb05167  Kaposi sarcoma-associated herpesvirus infection
myb05169  Epstein-Barr virus infection
myb05200  Pathways in cancer
myb05202  Transcriptional misregulation in cancer
myb05203  Viral carcinogenesis
myb05205  Proteoglycans in cancer
myb05206  MicroRNAs in cancer
myb05210  Colorectal cancer
myb05211  Renal cell carcinoma
myb05212  Pancreatic cancer
myb05213  Endometrial cancer
myb05214  Glioma
myb05215  Prostate cancer
myb05216  Thyroid cancer
myb05217  Basal cell carcinoma
myb05218  Melanoma
myb05219  Bladder cancer
myb05220  Chronic myeloid leukemia
myb05222  Small cell lung cancer
myb05223  Non-small cell lung cancer
myb05224  Breast cancer
myb05225  Hepatocellular carcinoma
myb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102245891 (CDKN1A)
   04630 JAK-STAT signaling pathway
    102245891 (CDKN1A)
   04066 HIF-1 signaling pathway
    102245891 (CDKN1A)
   04068 FoxO signaling pathway
    102245891 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    102245891 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102245891 (CDKN1A)
   04115 p53 signaling pathway
    102245891 (CDKN1A)
   04218 Cellular senescence
    102245891 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102245891 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    102245891 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102245891 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    102245891 (CDKN1A)
   05206 MicroRNAs in cancer
    102245891 (CDKN1A)
   05205 Proteoglycans in cancer
    102245891 (CDKN1A)
   05203 Viral carcinogenesis
    102245891 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102245891 (CDKN1A)
   05212 Pancreatic cancer
    102245891 (CDKN1A)
   05225 Hepatocellular carcinoma
    102245891 (CDKN1A)
   05226 Gastric cancer
    102245891 (CDKN1A)
   05214 Glioma
    102245891 (CDKN1A)
   05216 Thyroid cancer
    102245891 (CDKN1A)
   05220 Chronic myeloid leukemia
    102245891 (CDKN1A)
   05217 Basal cell carcinoma
    102245891 (CDKN1A)
   05218 Melanoma
    102245891 (CDKN1A)
   05211 Renal cell carcinoma
    102245891 (CDKN1A)
   05219 Bladder cancer
    102245891 (CDKN1A)
   05215 Prostate cancer
    102245891 (CDKN1A)
   05213 Endometrial cancer
    102245891 (CDKN1A)
   05224 Breast cancer
    102245891 (CDKN1A)
   05222 Small cell lung cancer
    102245891 (CDKN1A)
   05223 Non-small cell lung cancer
    102245891 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102245891 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102245891 (CDKN1A)
   05161 Hepatitis B
    102245891 (CDKN1A)
   05160 Hepatitis C
    102245891 (CDKN1A)
   05163 Human cytomegalovirus infection
    102245891 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102245891 (CDKN1A)
   05169 Epstein-Barr virus infection
    102245891 (CDKN1A)
   05165 Human papillomavirus infection
    102245891 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102245891 (CDKN1A)
   01522 Endocrine resistance
    102245891 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102245891
NCBI-ProteinID: XP_014385109
LinkDB
Position
Un
AA seq 164 aa
MSEPSRDARPIPRGSRACRRLFGPVDSEQLQRDCDALMASCVQEACDRWNFDFVTETPLE
GDFAWERVWSLDLPKPYLPSAPRRAQDSLGRSKRSGSSPALLQGTAQEDHVDLSLSCTLV
PRSPEQPEGSPGGPSTSQGRKRRQTSMTDFYHSKRRLIFSKRRP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtccgagccatcccgggatgcccgcccgatcccccgcggcagcagggcctgccgtcgc
ctgttcggccccgtggacagtgagcagctgcagcgagactgcgacgctctgatggccagc
tgcgtgcaggaggcctgtgatcgatggaacttcgactttgtcaccgagacaccgctggag
ggtgacttcgcctgggagcgggtgtggagcctggacctgcccaagccctacctgccctca
gcgccgaggagggcccaggacagcctgggaagaagcaagcggtccggcagctcacctgcc
ctgctgcaggggacagctcaggaggaccacgtggacctgtcactgtcctgcaccctggtg
cctcgctcccctgagcagcctgaggggtccccaggtgggccgagcacgtctcagggccgc
aaacggcggcagaccagcatgacagatttttatcactccaaacgccggctgatcttctcc
aagaggaggccctaa

DBGET integrated database retrieval system