KEGG   Myotis brandtii (Brandt's bat): 102246395Help
Entry
102246395         CDS       T02920                                 

Gene name
WDHD1
Definition
(RefSeq) WD repeat and HMG-box DNA binding protein 1
  KO
K11274  chromosome transmission fidelity protein 4
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
KEGG Orthology (KO) [BR:myb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:myb03036]
    102246395 (WDHD1)
Chromosome and associated proteins [BR:myb03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    102246395 (WDHD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mcl1_mid WD40 ANAPC4_WD40 eIF2A HMG_box
Motif
Other DBs
NCBI-GeneID: 102246395
NCBI-ProteinID: XP_005881360
LinkDB All DBs
Position
Un
AA seq 1129 aa AA seqDB search
MPATQKPMRYGHTEGHTDVCFDDSGSCIVTCGSDGDVRIWEDLDDDDPKSINVGEKAYSC
ALKSGKLVTAVSNNTVQVHTFPEGVPDGILTRFTTNANHVVFNSDGTKIAAGSGDFLVKV
VDVMDCSQQKTFRGHEAPVLSLSFDPKDVFLASASCDGSVRVWQISDQTCAISWPLLQKV
SDVINAKSICRLAWQPKSGKLLAVPVEKSVKLYRRETWNNQFDLSDNFISQTLNVVTWSP
CGQYLAAGSINGSIIVWNVETKECMERVKHEKGYAICGLAWHPTCGRIAYTDAEGNLGLL
ENVCNSNGKIPSSKVSSRVEKDYNDLFDGDDTSNAGDFLNDNTVETPSFSKGIINDDEDD
DIMLASGRPRQRSHFLEDDENSVDITMLKTGSSLLKEKEEDDQAESIYNLPLVTSQRPLY
DGPMPTPRQKPFQSGSTPSHLTHRFMVWNSIGIIRCYNDEQDNAIDVEFHDTSIHHATHL
SNTLNYTIADLSHEAILLACESTDELASKLHCLHFSSWDSSKEWIVDMPQNEDIEAICLG
QGWAAAATSALLLRLFSIGGVQKEIFSLPGPVVSMAGHGEQLFIVFHRGTGFDGDQCLGV
HLLQMGKKKQQILHGDPLPLTRKSYLVWVGFSAEGTPCFVDSEGIVRMLNRGLGNMWTPV
CNTREHCKGKSDHYWVVGIHENPQQLRCIPCKGSRFPPTLPRPAVAVLSFQLPYCQVATE
KGQMEEQFWRSVMFHNHLDYLAKNGYEYEENTKNQAIKEQQELLLKMLALSCKLEREFRC
VELAELMTQNAVNLAIKYASRSRRLILAQRLSELAVEKAAELAATQVEEEEEEVDFRKQL
SAGYSNTPTEWSQPRLRNQVEEEAEDTGEADDTEETSEVPKHGQNPFSKSANSSDVPAVK
SGAVTSSNTGRVNPFKVSANSKEPAISVNSGRSANILDNMNKSYKKSTALNRATNDEKSP
VIKPLVPKPKSKQASAVSYFQKRTPQADKTEEVKEENPKNSSSETPAMCPQNTENQRPKS
GFQMWLEENRSNILSDNPDFSDEADIIKEGMLRFRVLSTEERKAWTAKAKGGTASDGAEA
KKRKHVADESEETEHQEEKAKENLNLPKKQKPLDLSTNQKLSAFAFKQE
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccacacagaagccgatgagatacggacatacagagggacacacggatgtctgt
tttgacgattcggggagttgtattgtgacttgtggaagtgatggtgatgtgaggatttgg
gaagacttggatgatgatgatcctaagtccattaatgttggagaaaaggcatattcatgt
gctttgaagagtggaaaattggtcactgcagtatctaacaatactgttcaagtccataca
tttcccgaaggagttccagatggtatattgactcgcttcaccacaaatgcaaatcatgtg
gtctttaatagtgatggtaccaaaatcgctgctggatctggtgactttctagtcaaagtt
gtagatgtgatggattgcagccagcagaaaacatttcgaggacatgaagcccctgtttta
agtctttcctttgatcctaaggatgtctttctggcatcagctagttgtgatggatctgtc
agagtgtggcaaatttcagatcagacatgtgctattagttggccactgctacaaaaggtc
agtgatgtgataaatgcaaaatcaatctgcagacttgcttggcagccaaaaagtgggaag
ttactagcagttcctgtggaaaaatctgttaagctatatagaagagaaacttggaataat
caatttgatctttcagataatttcatctctcagaccctcaatgtagtaacctggtctcct
tgtgggcaatatttagctgcagggagtattaatggttcaattatagtttggaatgtggaa
accaaagagtgcatggaaagggtgaaacatgagaaaggttatgcaatttgtggcctggcc
tggcatcctacttgtggtcgaatagcttatactgatgcagaaggaaatctagggctcctg
gagaatgtttgtaactctaatggaaagataccaagcagtaaggtatctagcagagtggaa
aaagattacaatgatctttttgatggagatgatacaagtaatgctggtgattttctaaat
gacaatacagttgagaccccctctttttcaaaagggattataaatgatgatgaggatgat
gacatcatgctggcttcaggtcgtcctagacagcgaagtcacttcctagaagatgatgaa
aactcagttgatattacaatgctaaaaactggttctagtcttctgaaagagaaggaggaa
gatgatcaagcagaaagcatttacaacctaccacttgtaacatcccaaaggccattatat
gatgggccaatgccaactccccggcaaaagccctttcagtcaggttctacaccttcgcat
ctcactcacagattcatggtgtggaactctattggaatcattcgctgctataatgatgag
caagacaatgccatagatgtggagttccatgatacctccatacaccatgcaacacactta
tcgaacactttgaattatacaatagcggatctttcccatgaagctattttgttggcatgt
gaaagcactgatgaactagcaagcaagcttcactgcctacactttagttcttgggattca
agcaaagagtggatagtagacatgccccagaatgaggatattgaagccatatgccttggc
caggggtgggctgctgctgccactagtgccttgctccttcgattgttttctattggaggt
gttcagaaagagatcttcagtcttcctgggcctgtggtgtcaatggcaggacatggagaa
cagcttttcattgtttttcatagaggaacaggatttgatggggatcagtgccttggcgtt
cacttgttacagatggggaaaaagaaacaacaaattttgcatggtgatcctcttcctctc
acaaggaaatcctaccttgtatgggttggattttcagctgaaggtaccccctgttttgtg
gattcagaaggcattgttcgaatgcttaacagagggcttgggaatatgtggactcctgta
tgtaatacaagagaacactgcaaaggaaaatctgatcactactgggtggttggtatccat
gaaaatccccagcaactgaggtgcattccttgtaaaggctctcggtttcctcccaccctt
ccacgccctgctgtcgccgttttatcctttcagcttccttactgtcaggttgcaacagag
aagggacagatggaggaacagttttggcgttcagttatgtttcacaaccaccttgattat
ttagctaaaaatggttatgaatatgaagagaacactaaaaatcaagcaataaaagaacaa
caggaacttttactgaaaatgcttgcactttcctgtaaactggagcgagaatttcgttgt
gtggaacttgctgaactgatgactcaaaatgctgtgaatttagccattaaatatgcttct
cgttctcggagattaatattggcccaaagacttagtgaattggccgtagagaaggcagca
gaattggcagcaacccaggtggaagaggaggaagaggaagtagatttcagaaaacagctg
agtgctggttacagtaatactcctacagagtggagccagccaaggctcagaaatcaagtt
gaagaagaagcagaagacactggggaagctgatgatacagaagaaacatcagaagtacct
aagcatggacagaacccattttccaaaagtgcaaattcctctgatgtaccagctgttaag
tcaggtgcagttacctccagtaacacaggacgagtaaaccccttcaaggtatcagccaat
tccaaagagccagccatttcagtgaactcaggacgttctgctaatattttagacaatatg
aacaaatcatataagaaatctactgcacttaatcgagctacaaatgatgaaaagtctcca
gtaataaagcctctagttccaaagccaaaatctaagcaggcatctgcagtatcctatttc
cagaaaaggactccccaagctgataagaccgaggaagtgaaagaagaaaatcctaaaaat
tcgtcatctgaaaccccagctatgtgtcctcaaaacactgaaaaccaaaggccaaagagt
gggttccagatgtggctggaagaaaacagaagtaatattttgtctgataaccctgacttt
tcagatgaagcagatataataaaagaaggaatgcttcgatttagagtattatcaactgaa
gaaaggaaggcatggactgccaaggccaaaggtggaactgcaagtgatggagctgaagca
aagaagcgaaaacatgtggccgacgaaagtgaagaaactgaacaccaggaagaaaaagca
aaggagaatctcaatttgcctaaaaagcaaaaacctttagatctttctacaaatcagaaa
ctgtcagcttttgcatttaagcaggaatag

DBGET integrated database retrieval system