KEGG   Myotis brandtii (Brandt's bat): 102246940
Entry
102246940         CDS       T02920                                 

Gene name
IL2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04060  Cytokine-cytokine receptor interaction
myb04061  Viral protein interaction with cytokine and cytokine receptor
myb04151  PI3K-Akt signaling pathway
myb04625  C-type lectin receptor signaling pathway
myb04630  Jak-STAT signaling pathway
myb04658  Th1 and Th2 cell differentiation
myb04659  Th17 cell differentiation
myb04660  T cell receptor signaling pathway
myb04672  Intestinal immune network for IgA production
myb04940  Type I diabetes mellitus
myb05135  Yersinia infection
myb05142  Chagas disease (American trypanosomiasis)
myb05162  Measles
myb05166  Human T-cell leukemia virus 1 infection
myb05200  Pathways in cancer
myb05320  Autoimmune thyroid disease
myb05321  Inflammatory bowel disease (IBD)
myb05330  Allograft rejection
myb05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    102246940 (IL2)
   04151 PI3K-Akt signaling pathway
    102246940 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102246940 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102246940 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102246940 (IL2)
   04660 T cell receptor signaling pathway
    102246940 (IL2)
   04658 Th1 and Th2 cell differentiation
    102246940 (IL2)
   04659 Th17 cell differentiation
    102246940 (IL2)
   04672 Intestinal immune network for IgA production
    102246940 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102246940 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102246940 (IL2)
   05321 Inflammatory bowel disease (IBD)
    102246940 (IL2)
   05330 Allograft rejection
    102246940 (IL2)
   05332 Graft-versus-host disease
    102246940 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102246940 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102246940 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102246940 (IL2)
   05162 Measles
    102246940 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    102246940 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:myb04052]
    102246940 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:myb00536]
    102246940 (IL2)
Cytokines and growth factors [BR:myb04052]
 Cytokines
  Interleukins
   102246940 (IL2)
Glycosaminoglycan binding proteins [BR:myb00536]
 Heparan sulfate / Haparin
  Cytokines
   102246940 (IL2)
SSDB
Motif
Pfam: IL2 Surfac_D-trimer
Other DBs
NCBI-GeneID: 102246940
NCBI-ProteinID: XP_005865519
UniProt: S7PAW2
LinkDB
Position
Un
AA seq 150 aa
MYKMHFLSCIALTLAFIADGAPTSSSSQETQQQLEHLILDMQRLLNGVSNYKNSKLPMML
TFKFYMPRNATELKHLQCLVEELEPLEKVLKLEKSLSNITELMSNVNVLVQNLKGPETRF
KCDYDDETVTIVEFLNKWITFCQRIFSTLT
NT seq 453 nt   +upstreamnt  +downstreamnt
atgtacaagatgcacttcttgtcctgtattgcactaactctcgcattcatcgcagacggt
gcacctacctcgagctccagccaggaaacacagcagcagctggagcacctgatactggat
atgcagcggcttctgaatggagtcagcaattacaagaactccaagctccccatgatgctc
acgtttaagttttacatgcccaggaatgccacagaattgaaacatctgcagtgtctagta
gaagaacttgaacctctggagaaagtgctaaagttagagaaaagcttgagcaatattacg
gaattaatgagcaatgtcaatgtactcgttcagaacctgaagggacctgaaacgagattc
aaatgtgactatgatgatgagacagtgaccatcgtagaattcctgaacaagtggattacc
ttttgtcaaagaatcttctcaacactgacttaa

DBGET integrated database retrieval system