KEGG   Myotis brandtii (Brandt's bat): 102248472
Entry
102248472         CDS       T02920                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04010  MAPK signaling pathway
myb04060  Cytokine-cytokine receptor interaction
myb04068  FoxO signaling pathway
myb04144  Endocytosis
myb04218  Cellular senescence
myb04350  TGF-beta signaling pathway
myb04380  Osteoclast differentiation
myb04390  Hippo signaling pathway
myb04520  Adherens junction
myb04659  Th17 cell differentiation
myb04926  Relaxin signaling pathway
myb04933  AGE-RAGE signaling pathway in diabetic complications
myb05142  Chagas disease
myb05161  Hepatitis B
myb05166  Human T-cell leukemia virus 1 infection
myb05200  Pathways in cancer
myb05202  Transcriptional misregulation in cancer
myb05210  Colorectal cancer
myb05212  Pancreatic cancer
myb05220  Chronic myeloid leukemia
myb05225  Hepatocellular carcinoma
myb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102248472 (TGFBR2)
   04350 TGF-beta signaling pathway
    102248472 (TGFBR2)
   04390 Hippo signaling pathway
    102248472 (TGFBR2)
   04068 FoxO signaling pathway
    102248472 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102248472 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102248472 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    102248472 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102248472 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102248472 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102248472 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102248472 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102248472 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    102248472 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102248472 (TGFBR2)
   05212 Pancreatic cancer
    102248472 (TGFBR2)
   05225 Hepatocellular carcinoma
    102248472 (TGFBR2)
   05226 Gastric cancer
    102248472 (TGFBR2)
   05220 Chronic myeloid leukemia
    102248472 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102248472 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102248472 (TGFBR2)
   05161 Hepatitis B
    102248472 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102248472 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myb01001]
    102248472 (TGFBR2)
Enzymes [BR:myb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102248472 (TGFBR2)
Protein kinases [BR:myb01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   102248472 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 102248472
NCBI-ProteinID: XP_014404711
LinkDB
Position
Un
AA seq 569 aa
VCGPPFVLLPLSLPVSVVDLASATFLCRGVEDKVNSDVMITDNNGALKFSQLCKFCDVRS
STCDNQKSCRSNCSITSICEKPNEVCVAVWRKNDENITLETVCHDPALVYHGFVLEDAAS
PKCIMKEKKVDGETFFMCSCNTDECNDHIIFSEEYSTNNPDLLLVIFQVTGVSLLPPLVI
AIAVIIIFYCYRVHRKQKLTPSWETSKPRKLMDLSERLAIIIEDDRSDISSTCANNINHN
TELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKMEKDIFSDIN
LKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLCKLGSSLARGI
AHLHSDHTLCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQ
VGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKEYEPPFGSKV
REHPCVESMKDNVLRDRGRPEIPSSWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERF
SELEHLDRLSGRSCSEEKIPEDGSLGTTK
NT seq 1710 nt   +upstreamnt  +downstreamnt
gtatgtggacctccatttgttctcttgcccttgagccttccagtatcagtggtggatctg
gcctcagcaaccttcctgtgcagaggtgttgaggacaaagttaatagtgatgtgatgatc
accgacaacaatggtgcactcaagttttcacaattgtgtaaattctgtgacgtgagatct
tccacctgtgacaaccagaaatcgtgcaggagcaactgcagtatcacatccatctgtgag
aagcccaatgaagtgtgtgtggccgtctggaggaaaaacgatgagaacataacactagag
acggtctgccacgaccccgcgctcgtctaccatgggtttgttcttgaagatgccgcttct
ccgaagtgtattatgaaagagaagaaagtggatggcgagactttcttcatgtgttcctgt
aacacggatgagtgcaatgaccacatcatcttttcagaggaatattccaccaacaaccct
gacttattgttagtcatattccaagtgacaggcgtcagcctcctgccaccactggtcatc
gccatcgccgtcatcatcatcttctactgctaccgtgtccaccggaagcagaagctgacc
ccgtcctgggagaccagcaagccacggaagctcatggacctcagtgagcgcctggccatc
atcatagaagatgaccgctccgacatcagctccacgtgtgccaacaacatcaaccacaac
acggagctgctgcccattgagctggacaccctggtggggaaaggtcgctttgccgaggtc
tacaaggccaagctgaagcagaacacttcagagcagttcgagaccgtggcagtcaagatc
ttcccttatgaggagtatgcctcctggaagatggagaaagacatcttctcggacatcaac
ctgaagcacgagaacatcctccagttcctgacggctgaggagcggaagacggagttgggg
aagcagtactggctgatcactgctttccatgccaagggcaacctacaggagtatctcacg
agacacgtcatcagctgggaggacctgtgcaagctgggcagctccctggccaggggcata
gctcacctgcacagtgaccacaccctgtgcgggaggcccaagatgcccatcgtgcacagg
gacctcaagagctccaatatcctggtgaagaacgacctgacctgctgcctgtgtgacttt
gggctttccctgcgtctggaccccactctgtctgtggatgacttggccaacagtgggcag
gtgggaactgcaagatacatggccccggaagtcttagagtccaggatgaacttggagaat
gtcgagtccttcaagcagacagatgtctactccatggctctggtgctctgggagatgacg
tcccgctgcaatgcggtgggagaagtgaaagagtatgagcctccatttggttccaaggtg
cgggagcatccctgtgtcgaaagcatgaaggacaatgtgttgagagatcggggacgaccg
gaaattcctagctcctggctcaaccaccagggcatccagatggtgtgtgagactctgact
gagtgctgggaccacgacccagaagcccggctcacggcccagtgtgtggccgagcgcttc
agcgagctggagcacctggacagactctcggggaggagctgctccgaggagaagattccc
gaagatggctcgctgggcaccaccaaatag

DBGET integrated database retrieval system