KEGG   Myotis brandtii (Brandt's bat): 102249742Help
Entry
102249742         CDS       T02920                                 

Gene name
PIGT
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis class T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
myb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    102249742 (PIGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 102249742
NCBI-ProteinID: XP_014400016
LinkDB All DBs
Position
Un
AA seq 578 aa AA seqDB search
MAAAVRLPVLVLXLLGRGGWGHAEPPRDSLREELVITPLPSGDVAATFQFRTRWDSELQR
EEVSHYRLFPKALGQLIAKYSLRELHLSLTQGFWRTRYWGPPFLQAPSGAELWVWFQDTV
TDVDTSWKELSNVLSGIFCASLNFIDSTNTVTPTASFKPLGLANDTDHYFLRYAVLPREV
VCTENLTPWKKLLPCSSKAGLSMLLKADRLFHSSYHSQAVHIRPICRNARCTSISWELRQ
TLSVVFDAFVTGQGKKDWSLFRMFSRTLTEPCPLASESRVYVDITSYSQDNETLEVNPPP
LTTYQDVILGTRKTYAVYDLLNTAVINSSRNLNLQLKWKRPPENEAPPVPFLHAQRYVSG
YGLQSGELSTLLYNTHPYRAFPVLLLDIVPWYLRLYVHTLTITSKGKENKPSYIHYQPAQ
DRLQPHLLEMLIQLPASSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSVVA
AKPVDWEESPLFSSLFPVSDSSSYFMRLYTEPLLVSLPTPDFSMPYNVICLTCTVVAVCY
GSFYNLLTRTFHIEEPRTGGLAKRLANLIRRARGVPPL
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcagtgcggctcccggtgctggtgctgcngctcctggggcggggcggctgg
ggccatgcagagcccccgcgcgacagcctgcgggaggagctcgtcatcaccccgctgcct
tctggagacgtagccgccacattccagttccgcacgcgctgggattcggagctgcagcgc
gaagaagtttctcattataggctcttccccaaagccctggggcagttgatcgccaagtat
tctctccgggagctgcacctgtcactcactcaaggcttttggaggactcggtactggggg
ccacccttcctgcaggccccatcaggtgccgagctctgggtctggttccaagacaccgtc
acggatgtagatacatcttggaaggagctcagtaacgtcctctcagggatcttctgcgcc
tctctcaacttcatcgactccaccaacacggtcacccccactgcctccttcaaacccctg
gggctggccaatgacactgatcactatttcctacgctatgccgtgctgccacgggaggtt
gtctgcaccgagaacctcaccccctggaagaagctcttgccctgtagttccaaggcaggc
ctctctatgctgctgaaggctgatcgcttgttccactcgagctaccactcccaggcagtg
cacatccgccctatttgcagaaatgctcggtgtaccagcatctcctgggagctgaggcag
actctttccgttgtatttgatgccttcgtcacggggcaggggaagaaagactggtccctc
ttccggatgttctcccgaaccctcacagagccctgccccctggcttcagagagccgagtc
tacgtggacatcaccagctacagccaggacaatgagacattggaggtgaacccgcctccc
ctcaccacgtaccaggatgtcatcctgggcacccggaagacctacgctgtctacgacttg
ctcaacacggctgtgatcaacagctcccgcaacctcaacctccagctcaagtggaagaga
cccccggagaatgaggccccgccagtgcccttcctgcacgcccagcggtacgtgagtggc
tatgggctgcagagcggggagctgagcacgctgctgtacaacacccacccgtaccgggcc
ttccccgtgctgctcctggacatcgtgccctggtacctgcggctgtatgtgcacaccctt
accatcacctccaagggcaaggagaacaagccaagttacatccactaccagcctgcccag
gaccggctgcagccccacctcctggagatgctcattcagctgccggccagctcagtcacc
aaggtctccatccagtttgagcgggcgctgctcaagtggacggagtacaccccggacccc
aaccacggcttctacgtcagcccgtctgtcctcagtgccctcgtgcccagcgtggtggca
gccaaacccgtggactgggaagagagtcccctcttcagcagcctgttcccagtctccgac
agttctagctacttcatgcggctctacacggagccgctgctggtgagcctgccaacgccg
gacttcagcatgccctacaacgtcatctgcctcacgtgcacggtggtggccgtgtgctac
ggctccttctacaacctcctcacccggaccttccacatcgaggagcccagaacgggcggc
ctggccaagaggctggctaaccttatccggcgtgcccgcggcgtgcccccgctctga

DBGET integrated database retrieval system