KEGG   Myotis brandtii (Brandt's bat): 102250743
Entry
102250743         CDS       T02920                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04010  MAPK signaling pathway
myb04014  Ras signaling pathway
myb04015  Rap1 signaling pathway
myb04072  Phospholipase D signaling pathway
myb04151  PI3K-Akt signaling pathway
myb04640  Hematopoietic cell lineage
myb04916  Melanogenesis
myb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102250743 (KITLG)
   04014 Ras signaling pathway
    102250743 (KITLG)
   04015 Rap1 signaling pathway
    102250743 (KITLG)
   04072 Phospholipase D signaling pathway
    102250743 (KITLG)
   04151 PI3K-Akt signaling pathway
    102250743 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102250743 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    102250743 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102250743 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:myb04052]
    102250743 (KITLG)
Cytokines and growth factors [BR:myb04052]
 Growth factors
  Growth factors (RTK binding)
   102250743 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 102250743
NCBI-ProteinID: XP_005872299
LinkDB
Position
Un
AA seq 289 aa
MKKTQVADRYPEEHVLGVSETWIITCIYLQLLLFNHLVRTTGICTNRVTDDVKDVTKLVA
NLPKDYKIGLKYVPGMDVLPSHCWISKMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLV
KIVDDLVECMEEHPLENVKKSSNSLELKMFAPEEFFRIFNRSINAFKDLEMVSSKTSECV
FSSTLSPDNDSRVSVTKPFMLPPVAANSLRNDSSSSNRKALNSIGDSKLQWAAMTLPAFF
SLLVGFGFGALYWKKKQPNLTRAVENIQINEEDNEISMLQEKEREFQEV
NT seq 870 nt   +upstreamnt  +downstreamnt
atgaagaagacacaagtggcagacagatatccagaggaacatgtcctgggcgtatcagag
acttggattatcacttgcatttatcttcaactgctcctctttaatcatctcgtcagaact
acagggatctgcacgaaccgtgtcactgatgatgtgaaagacgttacaaaattggtggca
aatcttccaaaagactataagataggcctcaagtatgtccccggaatggacgttttgcct
agtcattgttggataagcaaaatggtggagcaattgtcagtcagcttgactgatcttctg
gacaagttttcaaatatttctgaaggcttgagtaattattctatcatagacaaacttgtg
aaaatagtagatgaccttgtggagtgcatggaagaacacccattggagaatgtaaaaaag
tcatctaacagcctagaactcaagatgtttgctcctgaagaattctttagaatttttaat
agatccatcaatgccttcaaggacttggagatggtgtcatctaaaactagcgaatgtgtg
ttttcttcaacattaagtcctgacaatgattccagagtcagtgtcacaaaaccatttatg
ttaccccctgttgcagccaactcccttaggaatgacagcagtagcagtaataggaaggcc
ttgaattccattggagactccaagctgcaatgggcagccatgacgttgccagcattcttc
tctcttttagttggctttggttttggagccttatactggaagaagaaacaaccaaatctt
acaagggcagttgaaaatatacagattaatgaagaggataatgagataagtatgttgcaa
gaaaaagagagagagtttcaagaagtctaa

DBGET integrated database retrieval system