KEGG   Myotis brandtii (Brandt's bat): 102251030Help
Entry
102251030         CDS       T02920                                 

Definition
(RefSeq) actin, cytoplasmic 1
  KO
K05692  actin beta/gamma 1
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04015  Rap1 signaling pathway
myb04145  Phagosome
myb04210  Apoptosis
myb04390  Hippo signaling pathway
myb04510  Focal adhesion
myb04520  Adherens junction
myb04530  Tight junction
myb04611  Platelet activation
myb04670  Leukocyte transendothelial migration
myb04714  Thermogenesis
myb04810  Regulation of actin cytoskeleton
myb04919  Thyroid hormone signaling pathway
myb04921  Oxytocin signaling pathway
myb05100  Bacterial invasion of epithelial cells
myb05132  Salmonella infection
myb05135  Yersinia infection
myb05164  Influenza A
myb05205  Proteoglycans in cancer
myb05225  Hepatocellular carcinoma
myb05410  Hypertrophic cardiomyopathy (HCM)
myb05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
myb05414  Dilated cardiomyopathy (DCM)
myb05416  Viral myocarditis
myb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102251030
   04390 Hippo signaling pathway
    102251030
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102251030
  09143 Cell growth and death
   04210 Apoptosis
    102251030
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102251030
   04520 Adherens junction
    102251030
   04530 Tight junction
    102251030
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102251030
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102251030
   04670 Leukocyte transendothelial migration
    102251030
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102251030
   04919 Thyroid hormone signaling pathway
    102251030
  09159 Environmental adaptation
   04714 Thermogenesis
    102251030
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102251030
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102251030
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102251030
   05410 Hypertrophic cardiomyopathy (HCM)
    102251030
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    102251030
   05414 Dilated cardiomyopathy (DCM)
    102251030
   05416 Viral myocarditis
    102251030
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102251030
   05135 Yersinia infection
    102251030
   05100 Bacterial invasion of epithelial cells
    102251030
  09172 Infectious disease: viral
   05164 Influenza A
    102251030
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:myb03021]
    102251030
   03019 Messenger RNA biogenesis [BR:myb03019]
    102251030
   03036 Chromosome and associated proteins [BR:myb03036]
    102251030
   03029 Mitochondrial biogenesis [BR:myb03029]
    102251030
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:myb04812]
    102251030
   04147 Exosome [BR:myb04147]
    102251030
Transcription machinery [BR:myb03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     102251030
Messenger RNA biogenesis [BR:myb03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     102251030
Chromosome and associated proteins [BR:myb03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     102251030
    NuA4 complex
     102251030
  Chromatin remodeling factors
   BAF complex
    102251030
   PBAF complex
    102251030
   SWR1 complex
    102251030
Mitochondrial biogenesis [BR:myb03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    102251030
Cytoskeleton proteins [BR:myb04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     102251030
Exosome [BR:myb04147]
 Exosomal proteins
  Proteins found in most exosomes
   102251030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 102251030
NCBI-ProteinID: XP_005870268
LinkDB All DBs
Position
Un
AA seq 375 aa AA seqDB search
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQVVMVGMGQKDSYVGDEAQS
KRGILTLKYPFEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEISVLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggatgacgatattgctgcgctagtggtcgacaacggctccggcatgtgcaaagccggc
ttcgccggggacgatgcccccagggccgtcttcccctccatcgtggggcgcccccggcac
caggttgtgatggtgggcatgggccagaaggactcctacgtgggtgatgaggcccagagc
aagagaggcatcctgaccctgaagtacccctttgagcacggcatcgtcaccaactgggac
gacatggagaagatctggcatcacactttctacaacgagctgcgtgtggcccccgaggag
caccctgtcctgctcaccgaggcccctctgaaccctaaggccaaccgtgagaagatgacc
cagatcatgttcgagaccttcaacacccccgccatgtacgtggccatccaggccgtgctg
tccctatacgcctctggccgtaccactggcatcgtgatggactccggagacggggtcacc
cacacggtgcccatctacgagggctacgccctcccccacgccatcctgcgtctggacctg
gctggccgggacctgaccgactacctcatgaagatcctcaccgagcgtggctacagcttc
accaccacggccgagcgggaaatcgtgcgtgacatcaaggagaagctgtgctacgtcgcc
ctggacttcgagcaggagatggccaccgcagcctccagctcctccctggagaagagctac
gagctgcccgacgggcaggtcatcaccatcggcaatgagcgcttccgctgccccgaggcc
ctcttccagccctccttcctgggtatggaatcctgtggcatccatgaaactacctttaac
tccatcatgaagtgtgacgtcgacatccgtaaggacctgtacgccaacacggtgctgtct
ggtggaaccaccatgtacccaggcatcgccgacaggatgcagaaggagatctctgttttg
gctcccagcacgatgaagatcaagatcatcgcgccccctgagcgcaagtactctgtgtgg
atcggcggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtatgacgagtccggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system