KEGG   Myotis brandtii (Brandt's bat): 102251586Help
Entry
102251586         CDS       T02920                                 

Gene name
ALDH1B1
Definition
(RefSeq) aldehyde dehydrogenase 1 family member B1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00010  Glycolysis / Gluconeogenesis
myb00053  Ascorbate and aldarate metabolism
myb00071  Fatty acid degradation
myb00280  Valine, leucine and isoleucine degradation
myb00310  Lysine degradation
myb00330  Arginine and proline metabolism
myb00340  Histidine metabolism
myb00380  Tryptophan metabolism
myb00410  beta-Alanine metabolism
myb00561  Glycerolipid metabolism
myb00620  Pyruvate metabolism
myb01100  Metabolic pathways
Module
myb_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102251586 (ALDH1B1)
   00053 Ascorbate and aldarate metabolism
    102251586 (ALDH1B1)
   00620 Pyruvate metabolism
    102251586 (ALDH1B1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102251586 (ALDH1B1)
   00561 Glycerolipid metabolism
    102251586 (ALDH1B1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102251586 (ALDH1B1)
   00310 Lysine degradation
    102251586 (ALDH1B1)
   00330 Arginine and proline metabolism
    102251586 (ALDH1B1)
   00340 Histidine metabolism
    102251586 (ALDH1B1)
   00380 Tryptophan metabolism
    102251586 (ALDH1B1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102251586 (ALDH1B1)
Enzymes [BR:myb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102251586 (ALDH1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 102251586
NCBI-ProteinID: XP_005883979
LinkDB All DBs
Position
Un
AA seq 517 aa AA seqDB search
MLRFLVPRLLCLRGRTAPYSSAAALPSPIQNPDIRYNQLFINNEWQDAVSKKTFPTVNPS
TGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYLA
SLETLDNGKPFQESYVLDLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGVCG
QIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITG
YGPTAGAAVAQHMDIDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADL
GHAVEQCHEALFFNMGQCCCAGSRTFVEESIYDEFLERTVEKAKQRKVGNPFELDTQQGP
QVDKEQFERILGYIRVGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGP
VQPLFKFKKIEEVIERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHT
PFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcttcctggtgccccggctgctttgcctccgaggcaggactgccccgtactcc
tcagcagcagcccttccaagccccatccagaacccagacattcgctacaaccagctattc
atcaacaacgagtggcaagatgcagtcagcaagaagaccttcccaacagtcaacccctct
acgggagaggtcatcggccatgtggccgaaggggaccgagccgatgtggatcgggcagtg
aaagcagctcgcgaggccttccgcctggggtctccatggcgccggatggatgcctctgag
cggggccggctgctgaaccgcctggctgacctagtggagcgggatcgtgtctacttggcc
tcactggagaccttggacaacgggaagcctttccaggagtcttatgtcttggacctggat
gaggtcatcaaggtgtaccggtactttgctggctgggctgacaagtggcacggcaagacc
atccccatggacggtgagcatttctgcttcacccggcatgagcccgtgggtgtctgtggc
cagataatcccgtggaacttccccttggtcatgcagggctggaaactcgccccggcactc
gccactggtaacaccgtggtcatgaaggttgcagagcagacccccctttctgccctgtac
ttggcctcgctcatcaaggaggcaggcttccccccgggggtggtgaacatcatcacaggc
tatggcccaacagcaggagcggccgtggcccagcacatggatattgacaaagttgctttt
actggctcaaccgaggtgggccacctgatccagaaggcagctggagattccaacctcaag
agagtcaccttagagctgggcgggaagagccccagcatcgtgttggcggacgctgacctg
ggccacgccgtggagcagtgccacgaagccctcttcttcaacatgggccagtgctgctgt
gcagggtcccggaccttcgttgaagaatccatctatgatgagtttctcgagagaacagtg
gagaaagcgaagcagaggaaagttgggaacccctttgagctggacacccagcaggggccc
caggtggacaaggagcagtttgagcgaatcctgggctacatccgggttggccagaaggag
ggggcaaaacttctctgcggtggggagcgttttggggagcggggtttcttcatcaagccc
acagtctttggtggcgtgcaagatgacatgaggattgccaaggaggagatctttgggcct
gtgcagcccctgttcaagttcaagaaaattgaggaggtgattgagagggccaacaacacc
aggtacggcttggctgccgctgtgttcacacgggacctggacaaggccatgtacttcaca
caggcactccaagccgggacggtgtgggtaaacacctacaacattgtcacgtgccacacg
ccgtttggaggctttaaggagtccggtaatgggagggagctgggggaggacgggcttaag
gcctacacagaggtgaagacagtcaccatcaaggttccacagaagaattcgtaa

DBGET integrated database retrieval system