KEGG   Myotis brandtii (Brandt's bat): 102251592
Entry
102251592         CDS       T02920                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04014  Ras signaling pathway
myb04390  Hippo signaling pathway
myb04392  Hippo signaling pathway - multiple species
myb05200  Pathways in cancer
myb05206  MicroRNAs in cancer
myb05219  Bladder cancer
myb05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102251592 (RASSF1)
   04390 Hippo signaling pathway
    102251592 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    102251592 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102251592 (RASSF1)
   05206 MicroRNAs in cancer
    102251592 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    102251592 (RASSF1)
   05223 Non-small cell lung cancer
    102251592 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH DUF5111 Mst1_SARAH
Other DBs
NCBI-GeneID: 102251592
NCBI-ProteinID: XP_005865453
LinkDB
Position
Un
AA seq 273 aa
MGSLIRLTLCRFPKATPKAASQSGPPRAHLCACGMPCRMGWLLKGPCCPIFQDEPVQWET
PDLSQAEIEQKIKEYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPASKKPPTLQD
ARRGPGRSTAVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFER
AERHGQVYLRKLSDDEQPLRLRLLAGPNEKALSFVLKENDSGEVNWDAFSMPELRNFLRI
LQREEEEHLRQILQKYSCCRQKIQEALHACPLG
NT seq 822 nt   +upstreamnt  +downstreamnt
atgggttctctcatcaggctcacgctttgtcggtttccaaaggctacgccaaaggccgct
tctcagagcggcccacccagggctcacctctgtgcctgtggcatgccttgccgcatggga
tggctccttaagggtccgtgctgccccatctttcaggacgagcccgtgcagtgggagaca
cctgacctttctcaggctgagattgagcagaagatcaaggagtacaatggccagatcaac
agcaacctcttcatgagcctgaacaaggacggctcctacacaggcttcatcaaggtgcag
ctgaagctggtgcgccctgtctccgtgcctgccagcaagaagcctcccaccttgcaggac
gcccggcggggcccagggcggagcacagccgtgaggcgccgcacctccttctacctgccc
aaggatgctgtcaagcacctgcacgtgttgtcacgcacgcgggcacgcgaggtcatcgag
gccctgctgcgcaagttcttggtggtggatgacccccgcaagtttgcactctttgagcgg
gccgagcgccacggccaagtgtacctccggaagctgtcggatgacgagcagcccctgcgg
ctacgactccttgcggggcccaatgagaaggccctgagcttcgtgctgaaggagaatgac
tctggggaggtgaactgggatgccttcagcatgcctgagctccgcaacttcctgcgcatc
ctacagcgggaggaagaggaacacctccgccagatcctgcagaagtactcctgttgccgc
cagaagatccaggaggccctgcatgcctgccccctggggtga

DBGET integrated database retrieval system