KEGG   Myotis brandtii (Brandt's bat): 102252013
Entry
102252013         CDS       T02920                                 

Gene name
IKBKG
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb01523  Antifolate resistance
myb04010  MAPK signaling pathway
myb04014  Ras signaling pathway
myb04062  Chemokine signaling pathway
myb04064  NF-kappa B signaling pathway
myb04151  PI3K-Akt signaling pathway
myb04210  Apoptosis
myb04380  Osteoclast differentiation
myb04620  Toll-like receptor signaling pathway
myb04621  NOD-like receptor signaling pathway
myb04622  RIG-I-like receptor signaling pathway
myb04623  Cytosolic DNA-sensing pathway
myb04625  C-type lectin receptor signaling pathway
myb04657  IL-17 signaling pathway
myb04658  Th1 and Th2 cell differentiation
myb04659  Th17 cell differentiation
myb04660  T cell receptor signaling pathway
myb04662  B cell receptor signaling pathway
myb04668  TNF signaling pathway
myb04920  Adipocytokine signaling pathway
myb05132  Salmonella infection
myb05135  Yersinia infection
myb05142  Chagas disease
myb05145  Toxoplasmosis
myb05160  Hepatitis C
myb05161  Hepatitis B
myb05162  Measles
myb05163  Human cytomegalovirus infection
myb05164  Influenza A
myb05165  Human papillomavirus infection
myb05166  Human T-cell leukemia virus 1 infection
myb05167  Kaposi sarcoma-associated herpesvirus infection
myb05168  Herpes simplex virus 1 infection
myb05169  Epstein-Barr virus infection
myb05170  Human immunodeficiency virus 1 infection
myb05200  Pathways in cancer
myb05203  Viral carcinogenesis
myb05212  Pancreatic cancer
myb05215  Prostate cancer
myb05220  Chronic myeloid leukemia
myb05221  Acute myeloid leukemia
myb05222  Small cell lung cancer
myb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
myb05340  Primary immunodeficiency
myb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102252013 (IKBKG)
   04014 Ras signaling pathway
    102252013 (IKBKG)
   04064 NF-kappa B signaling pathway
    102252013 (IKBKG)
   04668 TNF signaling pathway
    102252013 (IKBKG)
   04151 PI3K-Akt signaling pathway
    102252013 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102252013 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102252013 (IKBKG)
   04621 NOD-like receptor signaling pathway
    102252013 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    102252013 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    102252013 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    102252013 (IKBKG)
   04660 T cell receptor signaling pathway
    102252013 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    102252013 (IKBKG)
   04659 Th17 cell differentiation
    102252013 (IKBKG)
   04657 IL-17 signaling pathway
    102252013 (IKBKG)
   04662 B cell receptor signaling pathway
    102252013 (IKBKG)
   04062 Chemokine signaling pathway
    102252013 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102252013 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102252013 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102252013 (IKBKG)
   05203 Viral carcinogenesis
    102252013 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102252013 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102252013 (IKBKG)
   05221 Acute myeloid leukemia
    102252013 (IKBKG)
   05220 Chronic myeloid leukemia
    102252013 (IKBKG)
   05215 Prostate cancer
    102252013 (IKBKG)
   05222 Small cell lung cancer
    102252013 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    102252013 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102252013 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102252013 (IKBKG)
   05135 Yersinia infection
    102252013 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102252013 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    102252013 (IKBKG)
   05162 Measles
    102252013 (IKBKG)
   05164 Influenza A
    102252013 (IKBKG)
   05161 Hepatitis B
    102252013 (IKBKG)
   05160 Hepatitis C
    102252013 (IKBKG)
   05168 Herpes simplex virus 1 infection
    102252013 (IKBKG)
   05163 Human cytomegalovirus infection
    102252013 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102252013 (IKBKG)
   05169 Epstein-Barr virus infection
    102252013 (IKBKG)
   05165 Human papillomavirus infection
    102252013 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102252013 (IKBKG)
   05142 Chagas disease
    102252013 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102252013 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myb01001]
    102252013 (IKBKG)
Protein kinases [BR:myb01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102252013 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 Laminin_I Golgin_A5
Other DBs
NCBI-GeneID: 102252013
NCBI-ProteinID: XP_005886157
LinkDB
Position
Un
AA seq 414 aa
MSRPPWKSPLCEMVQPSGGPAGDQDMMGEESSLGKPAMLHLPSEQGAPETFQRCLEENQE
LRDAIRQSNQMLRECCEELQRFQGSQREEKEFLMQKFQEARKLVERLNLEKLDLKRQREQ
ALQEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKDRQALEARARAASEQ
ARQLESEREALQQQHSVQVDQLRMQNQSMEAALRKERQVASEEKRKLAQLQAAYHQLFQD
YDNRMKSSLMSNERNRGMQLEDLKQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPV
LKAQADIYEADFQAERQAREKLAEKKELLQEQLEQLQREYSRLKVSCQESARIEDMRKRH
VEVAQPPAQAHQSFHPAFIQRTPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIQ
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgagcaggcccccctggaagagtccactgtgtgagatggtgcagcccagcggtggcccg
gctggggaccaggacatgatgggtgaagagtcttctctggggaagccggccatgctccac
ctgccttcggagcagggtgctcctgagaccttccagcgctgcctggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagatgctgcgggagtgctgcgaggagctgcag
cgtttccagggcagccagagggaggagaaggagttcctcatgcagaagttccaggaggcc
aggaaactggtggagagactgaacctggagaagctggacctgaagaggcagagggagcag
gccctgcaggaggtggagcacctgaagagatgccagcagcagatggctgaggacaaggcc
tcggtgaaagcccaggtgacgtccttgctgggggagctccaggagagccagagtcgcttg
gaggctgccaccaaggatcggcaggctttggaagccagggcccgggcagccagtgagcag
gcccggcagctggagagcgagcgggaggcgctgcagcagcagcacagcgtgcaggtggac
cagctgcgcatgcagaaccagagcatggaggctgctctgcgcaaggagcgccaggttgcc
tcggaggagaagcggaagctggcgcaactccaggcagcctatcaccagctcttccaagat
tatgacaaccgcatgaagagcagcctgatgagcaatgagcgaaaccgaggaatgcagctg
gaagatctcaagcagcagctccagcaggccgaggaggccctggtggctaagcaggaattg
atcgataagctgaaggaagaggctgagcagcacaagattgtgatggagaccgttccggtg
ctcaaggcccaggcggatatctacgaggctgatttccaggctgagcggcaggcccgggag
aagctggccgagaagaaggagctgctgcaggagcagctggagcagctgcagcgggagtac
agcaggttgaaggtcagctgtcaggagtcggccaggattgaagatatgaggaagcggcat
gtagaggttgcccagccccctgcccaagctcaccagtcctttcaccccgcgttcatccag
agaacgccccccgaggagccacctgacttctgttgccccaagtgccagtatcaggctcct
gacatggacaccctgcagatccacgtcatggagtgcattcagtag

DBGET integrated database retrieval system