KEGG   Myotis brandtii (Brandt's bat): 102252017
Entry
102252017         CDS       T02920                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb01522  Endocrine resistance
myb04012  ErbB signaling pathway
myb04066  HIF-1 signaling pathway
myb04068  FoxO signaling pathway
myb04110  Cell cycle
myb04151  PI3K-Akt signaling pathway
myb04933  AGE-RAGE signaling pathway in diabetic complications
myb04934  Cushing syndrome
myb05162  Measles
myb05165  Human papillomavirus infection
myb05169  Epstein-Barr virus infection
myb05200  Pathways in cancer
myb05202  Transcriptional misregulation in cancer
myb05203  Viral carcinogenesis
myb05206  MicroRNAs in cancer
myb05215  Prostate cancer
myb05220  Chronic myeloid leukemia
myb05222  Small cell lung cancer
myb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102252017 (CDKN1B)
   04066 HIF-1 signaling pathway
    102252017 (CDKN1B)
   04068 FoxO signaling pathway
    102252017 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    102252017 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102252017 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102252017 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    102252017 (CDKN1B)
   05206 MicroRNAs in cancer
    102252017 (CDKN1B)
   05203 Viral carcinogenesis
    102252017 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    102252017 (CDKN1B)
   05220 Chronic myeloid leukemia
    102252017 (CDKN1B)
   05215 Prostate cancer
    102252017 (CDKN1B)
   05222 Small cell lung cancer
    102252017 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102252017 (CDKN1B)
   04934 Cushing syndrome
    102252017 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    102252017 (CDKN1B)
   05169 Epstein-Barr virus infection
    102252017 (CDKN1B)
   05165 Human papillomavirus infection
    102252017 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102252017 (CDKN1B)
SSDB
Motif
Pfam: CDI Multi-haem_cyto
Other DBs
NCBI-GeneID: 102252017
NCBI-ProteinID: XP_005866867
LinkDB
Position
Un
AA seq 198 aa
MSTVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFKNHKPLEGRYEWQEVEKASLPEFYYRAPRPPKGACKVPAQESQDVSGSRQAVPLVG
SQANSEDTHLAEQKTDASDSQPGLAEPCAGMRKRPAADDASSQNKRTNRTDENVSDGSPN
AGSVEQTPKKPGLRKRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaccgtgagagtgtctaacgggagcccgagcctggagcggatggacgccaggcag
gcggagtaccccaagccctccgcctgcagaaacctcttcggccccgtcgatcacgaagag
ttaacccgggacttggagaagcactgccgggacatggaagaggcgagccagcgcaagtgg
aattttgattttaagaaccacaagcccctggagggcagatatgagtggcaggaggtggaa
aaggccagcttgcccgagttctactaccgcgcgccacggccacccaaaggcgcctgtaag
gtgcccgcgcaggagagccaggatgttagcgggagccgccaggcggtgcctctcgtcggg
tcccaggcaaactcggaggacacgcacttggcggagcaaaagactgatgcgtcggacagc
cagccgggcttggcggagccgtgcgctgggatgaggaagcgacctgcagcggacgatgcc
tcttcgcaaaacaaaagaaccaacagaacagatgaaaatgtttcagacggttccccgaac
gcgggctccgtggagcagacgcccaagaagccgggcctcagaaaacgtcaaacgtaa

DBGET integrated database retrieval system