KEGG   Myotis brandtii (Brandt's bat): 102252927Help
Entry
102252927         CDS       T02920                                 

Gene name
PRKACA
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb01522  Endocrine resistance
myb04010  MAPK signaling pathway
myb04014  Ras signaling pathway
myb04020  Calcium signaling pathway
myb04024  cAMP signaling pathway
myb04062  Chemokine signaling pathway
myb04114  Oocyte meiosis
myb04140  Autophagy - animal
myb04211  Longevity regulating pathway
myb04213  Longevity regulating pathway - multiple species
myb04261  Adrenergic signaling in cardiomyocytes
myb04270  Vascular smooth muscle contraction
myb04310  Wnt signaling pathway
myb04340  Hedgehog signaling pathway
myb04371  Apelin signaling pathway
myb04530  Tight junction
myb04540  Gap junction
myb04611  Platelet activation
myb04713  Circadian entrainment
myb04714  Thermogenesis
myb04720  Long-term potentiation
myb04723  Retrograde endocannabinoid signaling
myb04724  Glutamatergic synapse
myb04725  Cholinergic synapse
myb04726  Serotonergic synapse
myb04727  GABAergic synapse
myb04728  Dopaminergic synapse
myb04740  Olfactory transduction
myb04742  Taste transduction
myb04750  Inflammatory mediator regulation of TRP channels
myb04910  Insulin signaling pathway
myb04911  Insulin secretion
myb04912  GnRH signaling pathway
myb04913  Ovarian steroidogenesis
myb04914  Progesterone-mediated oocyte maturation
myb04915  Estrogen signaling pathway
myb04916  Melanogenesis
myb04918  Thyroid hormone synthesis
myb04919  Thyroid hormone signaling pathway
myb04921  Oxytocin signaling pathway
myb04922  Glucagon signaling pathway
myb04923  Regulation of lipolysis in adipocytes
myb04924  Renin secretion
myb04925  Aldosterone synthesis and secretion
myb04926  Relaxin signaling pathway
myb04927  Cortisol synthesis and secretion
myb04928  Parathyroid hormone synthesis, secretion and action
myb04934  Cushing syndrome
myb04935  Growth hormone synthesis, secretion and action
myb04961  Endocrine and other factor-regulated calcium reabsorption
myb04962  Vasopressin-regulated water reabsorption
myb04970  Salivary secretion
myb04971  Gastric acid secretion
myb04976  Bile secretion
myb05012  Parkinson disease
myb05020  Prion diseases
myb05030  Cocaine addiction
myb05031  Amphetamine addiction
myb05032  Morphine addiction
myb05034  Alcoholism
myb05146  Amoebiasis
myb05163  Human cytomegalovirus infection
myb05165  Human papillomavirus infection
myb05166  Human T-cell leukemia virus 1 infection
myb05200  Pathways in cancer
myb05203  Viral carcinogenesis
myb05205  Proteoglycans in cancer
myb05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102252927 (PRKACA)
   04010 MAPK signaling pathway
    102252927 (PRKACA)
   04310 Wnt signaling pathway
    102252927 (PRKACA)
   04340 Hedgehog signaling pathway
    102252927 (PRKACA)
   04371 Apelin signaling pathway
    102252927 (PRKACA)
   04020 Calcium signaling pathway
    102252927 (PRKACA)
   04024 cAMP signaling pathway
    102252927 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102252927 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102252927 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102252927 (PRKACA)
   04540 Gap junction
    102252927 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102252927 (PRKACA)
   04062 Chemokine signaling pathway
    102252927 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    102252927 (PRKACA)
   04910 Insulin signaling pathway
    102252927 (PRKACA)
   04922 Glucagon signaling pathway
    102252927 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    102252927 (PRKACA)
   04912 GnRH signaling pathway
    102252927 (PRKACA)
   04913 Ovarian steroidogenesis
    102252927 (PRKACA)
   04915 Estrogen signaling pathway
    102252927 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    102252927 (PRKACA)
   04921 Oxytocin signaling pathway
    102252927 (PRKACA)
   04926 Relaxin signaling pathway
    102252927 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    102252927 (PRKACA)
   04918 Thyroid hormone synthesis
    102252927 (PRKACA)
   04919 Thyroid hormone signaling pathway
    102252927 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    102252927 (PRKACA)
   04916 Melanogenesis
    102252927 (PRKACA)
   04924 Renin secretion
    102252927 (PRKACA)
   04925 Aldosterone synthesis and secretion
    102252927 (PRKACA)
   04927 Cortisol synthesis and secretion
    102252927 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102252927 (PRKACA)
   04270 Vascular smooth muscle contraction
    102252927 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    102252927 (PRKACA)
   04971 Gastric acid secretion
    102252927 (PRKACA)
   04976 Bile secretion
    102252927 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102252927 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102252927 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    102252927 (PRKACA)
   04727 GABAergic synapse
    102252927 (PRKACA)
   04725 Cholinergic synapse
    102252927 (PRKACA)
   04728 Dopaminergic synapse
    102252927 (PRKACA)
   04726 Serotonergic synapse
    102252927 (PRKACA)
   04720 Long-term potentiation
    102252927 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    102252927 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    102252927 (PRKACA)
   04742 Taste transduction
    102252927 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    102252927 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    102252927 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    102252927 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102252927 (PRKACA)
   04714 Thermogenesis
    102252927 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102252927 (PRKACA)
   05205 Proteoglycans in cancer
    102252927 (PRKACA)
   05203 Viral carcinogenesis
    102252927 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102252927 (PRKACA)
   05020 Prion diseases
    102252927 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    102252927 (PRKACA)
   05031 Amphetamine addiction
    102252927 (PRKACA)
   05032 Morphine addiction
    102252927 (PRKACA)
   05034 Alcoholism
    102252927 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    102252927 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102252927 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102252927 (PRKACA)
   05163 Human cytomegalovirus infection
    102252927 (PRKACA)
   05165 Human papillomavirus infection
    102252927 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102252927 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102252927 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myb01001]
    102252927 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:myb03019]
    102252927 (PRKACA)
   03036 Chromosome and associated proteins [BR:myb03036]
    102252927 (PRKACA)
Enzymes [BR:myb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     102252927 (PRKACA)
Protein kinases [BR:myb01001]
 Serine/threonine kinases: AGC group
  PKA family
   102252927 (PRKACA)
Messenger RNA biogenesis [BR:myb03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     102252927 (PRKACA)
Chromosome and associated proteins [BR:myb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102252927 (PRKACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 102252927
NCBI-ProteinID: XP_014398782
LinkDB All DBs
Position
Un
AA seq 343 aa AA seqDB search
LSLLFLPVKEFLAKAKEDFLKKWENPDQNTANLDNFDRIKTLGTGSFGRVMLVKHKETGN
HFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGE
MFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGF
AKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIY
EKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQ
RKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ctctcccttctcttccttccagtgaaagagttcttagccaaagccaaagaagattttctt
aaaaaatgggaaaatcctgatcagaatacagccaatttggataactttgatcgaatcaag
accctcggcacaggctccttcgggcgggtgatgctggtgaaacacaaggagactgggaac
cacttcgccatgaagatcctggacaaacaaaaggtggtgaagctgaaacagatcgagcac
accctgaatgagaagcgcatcctgcaggctgtcaactttccgttccttgtcaaacttgag
ttttccttcaaggataactcaaatttatacatggtcatggagtatgtgcccggcggggaa
atgttctcacatctgcggcggattggcaggttcagcgagccccatgcccgcttctacgcc
gcccagatcgtcctgaccttcgagtatctgcactcgctcgatctcatctaccgggacctg
aagccagagaaccttctcatcgaccagcagggctacattcaggtgacagactttggtttc
gccaagcgtgtgaaaggccgcacctggaccttgtgcgggacccccgagtacctggcccct
gagatcatcctgagcaaaggctacaacaaggctgtggactggtgggccctgggggttctc
atctacgagatggctgctggctacccccccttcttcgctgaccagcccattcagatctac
gagaagattgtttctgggaaggtgcggttcccatcccacttcagctctgacctgaaggat
ctgctgcggaacctccttcaggtagaccttaccaagcgctttgggaacctcaagaatggg
gtcaatgacatcaagaaccataagtggtttgccacgactgactggattgccatctaccag
aggaaggtggaagctcccttcataccaaagtttaaaggccctggggacacgagtaatttt
gatgactatgaagaggaagagatccgagtctccatcaatgagaagtgtggcaaggagttt
tctgagttttag

DBGET integrated database retrieval system