KEGG   Myotis brandtii (Brandt's bat): 102253125
Entry
102253125         CDS       T02920                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00220  Arginine biosynthesis
myb00330  Arginine and proline metabolism
myb01100  Metabolic pathways
myb04020  Calcium signaling pathway
myb04066  HIF-1 signaling pathway
myb04146  Peroxisome
myb04371  Apelin signaling pathway
myb04926  Relaxin signaling pathway
myb05010  Alzheimer disease
myb05014  Amyotrophic lateral sclerosis
myb05022  Pathways of neurodegeneration - multiple diseases
myb05133  Pertussis
myb05140  Leishmaniasis
myb05142  Chagas disease
myb05145  Toxoplasmosis
myb05146  Amoebiasis
myb05152  Tuberculosis
myb05200  Pathways in cancer
myb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102253125 (NOS2)
   00330 Arginine and proline metabolism
    102253125 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102253125 (NOS2)
   04066 HIF-1 signaling pathway
    102253125 (NOS2)
   04020 Calcium signaling pathway
    102253125 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102253125 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102253125 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102253125 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102253125 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102253125 (NOS2)
   05014 Amyotrophic lateral sclerosis
    102253125 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102253125 (NOS2)
   05152 Tuberculosis
    102253125 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102253125 (NOS2)
   05145 Toxoplasmosis
    102253125 (NOS2)
   05140 Leishmaniasis
    102253125 (NOS2)
   05142 Chagas disease
    102253125 (NOS2)
Enzymes [BR:myb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102253125 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 102253125
NCBI-ProteinID: XP_014403700
LinkDB
Position
Un
AA seq 1039 aa
MTLQDTLHHKAKADLACRSKCCLGSIMNSKSLTRGPRDKPTSPDELLPQAIEFVNQYYSS
FKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIYATKQAWRNAPRCIGRIQWSNLQVFD
ARSCSTAQEMFEHICRHLRYSTNNGNIRSAITVFPQRSDGKHDFRVWNSQLIRYAGYQMP
DGTIRGDPACVEFTQLCIDLGWKPKYGRFDVVPLVLQAGGRDPELFEIPPDLVLEVPMEH
PKYEWFRELGLKWYALPAVSNMLLEVGGLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILE
EVGRRMGLETHKLASLWKDQAVVEINVAVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRS
RGGCPADWIWLVPPISGSITPVFHQEMLNYVLSPFYYYQVEAWKTHVWQDGKRRPRRREI
RFQVLVKAVLFASMLMRKTMASRVRATILFATETGKSETLAQDLGALFSCAFNPKVLCMD
EYRLSSLEEEQLLLVVTSTFGNGDSPGNGAKLKKSLFMLKELTNKFRYAVFGLGSSMYPQ
FCAFAHDVDQKLSHLGASQLTPTGEGDELSGQEEAFRSWAVQTFKAACEAFDVRGKDRIQ
IPKLYTTNVTWDPHHYRLVRDSQPLDLNKALSGMHAKNVFTMKLKSRQNLQSPKSSRITL
LVELSCEGSPGLSYQPGEHLGVFPSNQPALVQGILERVVDGPAPHQPVCLETLSETGSYW
VRDKRLPPCSPSQALTYFLDITTPPTQLLLRKLAQLATEEPERQRLQTLCQPSEYNKWKF
TNSPTFLEVLEEFPSLRVSASFLLSQLPVLKPRYYSISSSRDRTPTEVHLTVAVLTYRTR
DGQGPLHHGVCSTWLSSLKPQDPVPCFVRSASGFQLPEDPSRPCILIGPGTGIAPFRSFW
QQRLHDTEHKGLRRGHMTLVFGCRRPDEDHLYREEMLEMARKGVLHEVHTAYSRLPGQPK
VYVQDILQQQLDVAHTLKQLVAARLSLSEEQVEDYFFQLKSQKRYHEDIFSAVFPYKMKK
DGAAGQPSDPRAPTAHRRS
NT seq 3120 nt   +upstreamnt  +downstreamnt
atgactctccaagacacacttcaccacaaggccaaagcggatttggcttgcaggtccaag
tgttgcttgggatccatcatgaactccaaaagcttgaccagaggacccagggacaagcct
acctccccagatgaacttctacctcaagctatcgaatttgtcaaccagtattacagctcc
ttcaaagaggcaaaaatagaggaacatctggccagggtggaagctgtaacaaaggagata
gaaacaacaggaacctaccagctgacgggagatgagctcatctacgccaccaagcaggcc
tggcgcaatgccccacgctgcatcgggaggatccagtggtccaacctgcaggtcttcgac
gcccggagctgttccactgcccaggaaatgttcgagcacatctgcagacacctgcgttac
tccaccaacaacggcaacatcaggtcggccatcacggtgttcccccagcggagcgatggg
aagcacgacttccgggtctggaactcccagctcatccgctatgccggctaccagatgcct
gatggcaccatccgaggggaccctgcctgcgtggagttcacccagctgtgcatcgacctg
ggctggaaacccaagtacggccgcttcgacgtggtgcctctggtcctgcaggccggcggc
cgagaccctgagctcttcgagatcccgcctgatcttgtgctcgaggtgcccatggaacat
cccaagtatgagtggttccgggagctggggctgaagtggtacgccctgcctgccgtgtcc
aatatgctgctcgaggtgggtggcctggagtttccagggtgccccttcaacggctggtac
atgggcacagagatcggggtgcgggacttctgtgacgtccagcgctacaacatcctggag
gaggtgggcagaaggatgggcctggaaacgcacaagctggcctcgctctggaaggaccag
gctgtcgttgagatcaatgtcgccgtgctccacagtttccagaagcaaaatgtgaccatc
atggaccaccactcagctgcagagtccttcatgaagtacatgcagaacgagtaccggtcc
cgagggggctgccccgccgactggatttggctggtgccccccatttctggaagcatcacc
cccgtgttccaccaggagatgttaaactatgttctgtcccctttctactactaccaggtg
gaggcctggaaaacccacgtctggcaggacgggaagcggaggccccggagaagagagatt
cggtttcaagtcttggttaaagccgtgctctttgcctctatgctgatgcgcaagaccatg
gcgtcccgagtcagagccaccatcctctttgcgacggagacgggaaaatcggaaactctg
gctcaggacctaggggctttgttcagctgtgccttcaaccccaaggttctctgcatggac
gagtacaggctgagcagcctggaggaggagcagctgctgctggtggtgaccagcaccttt
gggaacggagactcccccggcaatggagcgaagctgaagaaatccctcttcatgctgaaa
gagctcaccaacaagttcaggtatgccgtgtttggcctcggttccagcatgtaccctcag
ttctgcgccttcgctcatgatgtcgaccagaagttgtcccacctgggagcgtctcagctc
accccgacgggggaaggggacgagctcagtgggcaggaagaggccttccgcagctgggcc
gtgcaaaccttcaaggcagcctgtgaggcgttcgatgtccgaggcaaagaccgcattcag
atccccaagctctacaccaccaatgtgacctgggacccgcaccactaccggcttgtgcgg
gactctcagcctttggacctcaacaaagccctcagcggaatgcacgccaagaatgtgttc
accatgaagctcaaatcgcggcagaatctacagagccccaaatccagccgcatcacgctc
ctggtggaactctcctgcgagggcagcccaggcctcagctaccagcctggagagcacctg
ggggttttcccaagcaaccagccagccctggttcaaggcattttggagcgagtggtggac
ggccccgcaccccaccaacccgtgtgcctggagaccctcagcgagaccggcagctactgg
gtcagggacaagcggctgcccccctgctcccccagccaggccctcacctacttcctggac
atcaccacgcccccaacccagctgctgctccgaaagctggcccagctggccacagaagaa
ccggagaggcagaggctacagaccctgtgccagccctcagagtacaacaagtggaagttc
accaacagtcccacattcctggaggtgctggaggagttcccgtccctgcgggtatctgcc
agcttcctgctctcccagctccctgtcctgaaaccccggtactactccatcagctcctcc
agggaccgcacccccacggaggtccacctcaccgtggccgtgctcacctaccgcacccga
gatggccagggtcccctgcaccacggtgtctgcagcacatggctcagcagcctgaaaccc
caagacccagtgccttgttttgtaagaagtgccagcggcttccagctccccgaggacccc
tcccgtccttgcatcctcattgggcccggcacgggcatcgcccccttccgcagtttctgg
cagcagcgactccatgacactgagcacaaagggctccggagaggccacatgaccctggtg
tttgggtgccggcgcccagatgaggaccacctttaccgggaggagatgttggagatggcc
cggaagggggtgctgcatgaggtgcacacagcctattctcgcctgcctggccagcccaag
gtctacgttcaagacatccttcagcagcagctggatgtggcccacacactgaagcagctg
gtggctgccaggctgagcctgagtgaggagcaggtcgaggactatttcttccagctgaag
agccagaagcgctatcatgaagacatcttcagtgctgtgtttccctacaagatgaaaaag
gatggggcagcgggacagcctagtgatcccagagctccaacagcccacaggagaagttaa

DBGET integrated database retrieval system