KEGG   Myotis brandtii (Brandt's bat): 102253534Help
Entry
102253534         CDS       T02920                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00040  Pentose and glucuronate interconversions
myb00051  Fructose and mannose metabolism
myb01100  Metabolic pathways
Module
myb_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102253534 (SORD)
   00051 Fructose and mannose metabolism
    102253534 (SORD)
Enzymes [BR:myb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     102253534 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 102253534
NCBI-ProteinID: XP_005877588
LinkDB All DBs
Position
Un
AA seq 356 aa AA seqDB search
MAAAKPENLSLVVHGPGDLRLENYPIPEPGPNEVLLKMHSVGICGSDVHYWQHGRIGDFI
VKKPMVLGHEASGTVVKVGSLVKHLQQGDRVAIEPGAPREIDEFCKIGRYNLSPTIFFCA
TPPDDGNLCRFYKHDANFCYKLPDNVTFEEGALIEPLSVGIHTCRRAGVTLGNKVFVCGA
GPIGLVNLLVAKAMGAAQVVVTDLSASRLSKAKEVGADFVLQITKESPQEIASKVEGLLG
CKPEVTIECTGAEAAIQAGIYATCPGGTLMLVGLGSEMVNVPLVHAAIREVDIKGVFRYC
NTWPMAISMLASKSVNVKSLVTHRFPLEKALEAFETSKKGLGLKVMIKCDPNDQNP
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccaagcccgagaacctgtctctggtggttcacggacccggggacctgcgc
ctggagaactaccctattcctgaaccaggcccaaatgaggtgctgctgaagatgcattcc
gttggaatctgcggctcagatgtccactactggcagcatggtcgaattggggattttatt
gtgaaaaagccaatggttctgggtcatgaagcatcaggaacagtcgtaaaagtggggtca
ttggtaaagcacctacaacaaggtgatcgcgttgccatcgagcctggtgctcctcgagaa
atcgatgaattttgcaagattggccgatacaacctgtcaccaaccatcttcttctgtgcc
acgccccccgatgatgggaacctctgccggttctataagcacgatgccaacttctgctac
aagcttcctgacaatgtcacctttgaggaaggggccctgattgagccactgtctgtgggg
atccatacctgccggcgagctggagtcaccctggggaacaaggtctttgtatgcggagct
gggccaattggattggtcaatttgctggtggccaaggcaatgggcgcagctcaagtggtg
gtgactgatctgtctgcctctcggttgtctaaagccaaggaagttggggctgactttgtc
ctccagatcaccaaggagagcccgcaggaaatcgccagtaaagtggaaggtctcctgggg
tgcaagccagaagtcaccatcgagtgcactggggcggaggccgccatccaggcgggcatc
tacgccacttgtcctggtgggaccctgatgcttgtaggactgggttctgagatggtcaat
gtgcccctagtgcatgcagccatccgagaagtggatatcaagggcgtgtttcgatactgc
aacacatggccgatggcgatttcaatgcttgcatccaagtctgtgaatgtgaagtcttta
gtgacccataggtttcctctggagaaagcgctggaggcctttgaaacatccaaaaagggt
ttggggttgaaagtcatgatcaagtgcgaccccaatgaccagaatccctga

DBGET integrated database retrieval system