KEGG   Myotis brandtii (Brandt's bat): 102254038Help
Entry
102254038         CDS       T02920                                 

Gene name
TUBGCP6
Definition
(RefSeq) tubulin gamma complex associated protein 6
  KO
K16573  gamma-tubulin complex component 6
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
KEGG Orthology (KO) [BR:myb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:myb03036]
    102254038 (TUBGCP6)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:myb04812]
    102254038 (TUBGCP6)
Chromosome and associated proteins [BR:myb03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    gamma-tubulin ring complex
     102254038 (TUBGCP6)
Cytoskeleton proteins [BR:myb04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Gamma-tubulin complex components
     102254038 (TUBGCP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCP_C_terminal GCP_N_terminal
Motif
Other DBs
NCBI-GeneID: 102254038
NCBI-ProteinID: XP_014404669
LinkDB All DBs
Position
Un
AA seq 1590 aa AA seqDB search
QLAGTGPPQVLPRRRDLFLNNKHVGRNVPYGGYDCYDLSVFEMDVQALIRREEYLCQDTI
HKALQVMEATPGTGLPTARLFSYGDPGGDRFERDTRVSLFGALVHSRTYDMDVRLDLPPV
PDSADLSGLAIKVPQSVDPSEDEGFQSASNLTPDSQSEHGTTPEIDPWDAVLTYEASKRR
CWEQVGCPPGHREEPYLTEAGRDAFDSFCRLCRRELQVLGGGLPQAAQPVLVQECELVKD
VLNVLIGVMSATFPLCQPTQAFMVKRGIHVSGTSPESISSLLSEVAECGTHYARLSHFSL
QPVLDASCSKGLVFQAFSSGLRRYLQYYRACVLSTPPTLSLLTIGFLFKKLGRQLRYLAE
LCGVGTCGGESRAPFPTGVKLLSYLYQEALDNCSNEHYPVLLSLLKTSCEPYTRFIYDWV
YSGVFRDVYGEFMIQVNHDYLGFRDKSYWTHGYVLISKEAGDCVPAFLKHIAQDVYVCGK
TINLLKLCCPRHYLCWSDVPVPRISVIFSLEELKEIEKDCAIYVGRMERVARHSSISKEE
KELRMEIAKQELIVQAREAASRVLSALSDRQMSERMALDARKREQFQRLKEQFMKDQERR
RAARQEELDDDFSYARELRDRARRLQALEEQLERKARQALVDHYSKLSAEAARREQKALW
KVQRHRLASARARFLLEDQEHIQAMLRDASEGRPPEPPAVLPSACSQASSLGPGHPDGGG
SCDPGCAEQHVAAWDGPSRPRELTPQPLEPPALGACSGSELGAGLQPGQAEGPGLFSAGL
SIQDFLPTGQGADQPGDAGVAPVLEEALQTIGSDLRSSASSATAGTGCSGPQEYDFRTVL
RPALVTSVPGSLQTVGGSLGCEGLQLWGDTHEFRLDTCVPDGQVALPHPSLPRNNLPEEG
SSQAMGQPLGHVSEGGILTGGYASGMAPSRPRWNVHGHVSDASIKVGENVWDVASSRPRW
NIHGHVSDASIKVGENVWDVAPSRPRWNVHGHVSQSQVMLGAPPGETQPDTPRPLPSPPD
HVSQPGLSLGAQSPTWDHDSQLLAEPASVGACARVAGSGEEGGLQALPGAEAGPSAVGDG
TPEPGQWSAELSCRWWCLGPGGGGGRAGSLLSWGLGRCCPQQALALTPPPRPFVLLGPGR
SGDTEDGSASQPSSSQERAASLSSPGLEEEAEAGAVARRQGREQAYLAGLVEQYRLEQYP
DSYEAMSEPPVARLLHHGLPRAFSLPEDTRGPLGTEETVDETAVQLSELLPLPVLMXXXX
XXPLPSVSLVNKAAVDYFFVELQLEAHFEALRHFLLMEDGEFAQSLSDLLFEKLGAGQTP
GELLNPLVLNAVLRKALQYSLHGDSPLAANLSFALKFLPEAFVPNAPDVLSCLELRYKVD
WPLNIVITESCLSRYSGIFSFLLQLKLMMWTLKDVCFHLKRTALVSPAAGSVQFRQLQLF
KHEMQHFVKVIQGYIANQILHVTWCEFRARLATVGDLEEIQRAHAEYLHKAVFRGLLTEK
AAPVMNIIHSVFSLVLKFRSQLISQPWGPAGGPHGAEHPNFALMQQSYNTFKYYSHFLFK
VVTKLVNRGYQPHLEDFLLRINFNNYYQDA
NT seq 4773 nt NT seq  +upstreamnt  +downstreamnt
cagctggcgggcaccgggcccccgcaggtcctgccccgccggcgggacctcttcctgaac
aacaagcacgtggggaggaacgtcccctacggcggctacgactgctacgacctgagtgtg
ttcgagatggacgtgcaggctctgatccgccgggaggagtacctgtgtcaggacacgatc
cacaaggcgcttcaggtgatggaggccacgccgggcaccggcctgcccacggcccggctc
ttctcctacggcgaccccggcggggacaggttcgagagagacacccgcgtctcgctgttc
ggagccctggtgcacagtcgcacctacgacatggacgtccggctggacttgcccccggtg
cccgacagcgcggacctctcggggctggccatcaaggtgcctcagagtgtggatccgtcc
gaagatgaagggttccagtcagcatccaatttgactcccgactcccagtctgagcacggc
acgaccccggagatcgacccctgggacgcggtgctcacctacgaggccagcaagcggagg
tgctgggagcaagtcggctgcccccctggccacagagaagagccctacctcacggaggcg
ggaagggacgccttcgacagtttctgcaggctgtgccgacgcgagctgcaggtgctgggc
gggggcctcccgcaggccgcgcagcccgtgctggtgcaggagtgcgagctggtgaaggac
gtgctgaacgtcttgatcggggtcatgtctgccacgtttcccctctgccagccgactcag
gccttcatggtgaagcggggcatccacgtgtcaggaacgtcccccgagagcatcagcagc
ctcctctcagaggtggccgagtgcgggacccactacgcacgcctgagccacttctctctg
cagcccgtgctggacgcctcctgcagcaagggcctcgtgttccaggccttcagcagcggc
ctgaggaggtacctgcagtattaccgggcgtgtgtcctctccaccccgcccactctgagc
ctcctcaccattggctttctcttcaagaagctgggccggcagctcaggtacctggctgag
ctctgtggtgtgggcacctgcggaggagagtcccgggctcctttccccactggcgtgaag
ctgctctcctacctctaccaggaggccctggacaactgcagcaatgagcactacccggtg
ctgctgtccctgctcaagaccagctgtgagccctacactcggttcatctatgattgggtg
tacagtggggtcttcagagacgtttatggcgagttcatgatccaggtgaaccatgactac
ctgggcttcagagataagtcctactggacccacggctacgtgctcatctccaaggaggcg
ggggactgtgtgcccgcgttcctgaagcacatcgctcaggacgtgtacgtctgcgggaag
accatcaacctgctgaagctctgctgccctcggcattatctctgctggtccgacgtcccc
gtgccccggatctcggtgattttctcccttgaggagctgaaggagattgagaaggactgt
gccatctacgtggggcggatggagagggtggcacgccacagctccatcagcaaggaggag
aaggaattacgaatggagattgctaagcaagaattaatcgtccaagcccgagaagcggcg
tccagggtcctgagtgcgctgagcgatcggcagatgtctgagcggatggccttggacgcc
cggaagcgagagcagtttcagaggctgaaagagcagttcatgaaggaccaggagcgacgc
cgggcggcccggcaggaggagctggacgatgacttcagctacgcccgggagctccgcgac
agggcgcggaggctgcaggccctggaggagcagctggagaggaaggcgaggcaggcgctg
gttgaccattatagcaagttgtctgcagaggcagctcgtcgagagcagaaagcgctgtgg
aaagtccagaggcaccggctggcgagcgcacgggctcgctttctcttagaagatcaggag
cacattcaggccatgctgagagacgcatccgaggggaggccccccgagccgccagcggtg
ctcccgagtgcgtgctcccaggcctcgtctctgggccctgggcaccccgatggaggtggc
agctgtgatcctgggtgtgcagagcagcacgtggctgcctgggatggcccaagccggcca
cgggagctgacgccacagcccctcgagcctccagcactgggggcctgcagtggctcagag
ctgggagcaggcctgcagccagggcaggccgaggggccagggctgttctctgcaggcctc
agtatccaggatttcctgcccacgggccagggtgctgatcagcctggggacgctggggtg
gcccctgtcttggaggaggccctgcagaccatcggctcagatctgcgctcctctgcttcg
tcagccacagcgggcacgggctgctcggggccacaggagtacgatttcagaactgtcctg
aggccagctctggtcacttcggtcccagggtccctccagactgtgggaggcagcttaggc
tgcgaggggctgcagctgtggggggacactcacgagtttaggctggacacctgtgtcccg
gatgggcaggtggctctgcctcacccatccctacccaggaataacctccccgaggagggg
agtagccaggccatggggcagcctcttgggcatgtgtctgagggtggtattctcacaggg
ggctatgcttctggaatggccccctcccggccacggtggaacgtccacggacacgtgtct
gatgccagcatcaaggtgggggagaacgtgtgggacgtggcatcctcccggccacggtgg
aacatccacggacacgtgtctgatgccagcatcaaggtcggggagaacgtgtgggatgtg
gctccctcccggccacggtggaatgtccacggacacgtgtctcagtcccaggtgatgctg
ggggcgcccccaggggaaacccagcctgatacgcccaggccccttccgagcccccctgac
cacgtgtcccagccaggcctcagcctgggagcacagagccctacttgggaccatgactca
cagctgctggcagaaccagcctcagtcggcgcctgcgctcgggtggctggctctggggaa
gaaggtggcctccaggccttgccgggtgctgaggctggacccagtgctgtgggagacggc
acccctgagccaggtcagtggtctgcagagctgtcctgtcgctggtggtgtctgggtcca
ggagggggaggaggaagggcgggaagtctgctgtcctggggacttgggaggtgctgccca
cagcaggcactggccctgactccccctccccgcccatttgtgctgctaggcccagggagg
agtggggacaccgaggacggctctgcaagccagccttccagctcacaggaacgtgcagcc
tccctgagcagcccgggcctggaagaggaggcggaggccggggcagtggccaggcgccag
ggcagggagcaggcctacctggcaggcctggtggagcagtaccgcctggagcagtacccg
gacagctacgaggccatgtcagagcctcccgtcgcgcgcctcctacaccatgggcttcct
cgggccttctcgctccccgaggacacccggggcccgctgggcacggaggagaccgtggat
gagaccgcggtgcagctgagcgagctgctgccgctgcctgtgctcatgnnnnnnnnnnnn
nnnncacccctccccagcgtgtccctggtgaacaaggcagcggtggactacttcttcgtg
gaactgcagctcgaggcgcacttcgaggcgctgcggcacttcctgctgatggaggacggc
gagttcgcgcagtccctgagcgacttgctcttcgagaagctgggcgccgggcagacgccc
ggggagctcctcaacccgctggtgctcaacgcggtgctgcgcaaggcgctgcagtacagc
ttgcatggggactccccactcgccgccaacctctccttcgccctcaagttcctgccggag
gccttcgtccccaacgctccggatgtgctgagctgcctggagctcaggtacaaggttgac
tggcccctcaacatcgtcatcaccgagagctgcctgagcaggtacagcggcatcttctcc
ttcctgctgcagctgaagctcatgatgtggacgctcaaggacgtgtgttttcacctcaag
cgcacagctctggtgagccctgcagccggctccgtgcagttccgccagctgcagctgttc
aaacacgagatgcagcacttcgtgaaggtcatccagggctacatcgccaaccagatcctg
cacgtcacctggtgtgagttccgggcccggctggccacagtgggcgacctcgaggagatc
cagcgcgcccatgccgagtacctgcacaaggccgtcttcaggggcctgctgacggagaag
gcggctcccgtcatgaacatcatccacagcgtcttcagcttggtcctcaagttccgcagc
cagctcatctcccagccctggggcccagccggtggcccccacggcgctgagcaccccaac
tttgccctcatgcagcaatcctacaacaccttcaagtactactcccacttccttttcaaa
gtggtgaccaagctggtgaaccgaggctaccagccccacctggaggacttcctgctgcgc
atcaacttcaacaattactaccaggacgcctga

DBGET integrated database retrieval system