KEGG   Myotis brandtii (Brandt's bat): 102254132Help
Entry
102254132         CDS       T02920                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00010  Glycolysis / Gluconeogenesis
myb00053  Ascorbate and aldarate metabolism
myb00071  Fatty acid degradation
myb00280  Valine, leucine and isoleucine degradation
myb00310  Lysine degradation
myb00330  Arginine and proline metabolism
myb00340  Histidine metabolism
myb00380  Tryptophan metabolism
myb00410  beta-Alanine metabolism
myb00561  Glycerolipid metabolism
myb00620  Pyruvate metabolism
myb01100  Metabolic pathways
Module
myb_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102254132 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    102254132 (ALDH2)
   00620 Pyruvate metabolism
    102254132 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102254132 (ALDH2)
   00561 Glycerolipid metabolism
    102254132 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102254132 (ALDH2)
   00310 Lysine degradation
    102254132 (ALDH2)
   00330 Arginine and proline metabolism
    102254132 (ALDH2)
   00340 Histidine metabolism
    102254132 (ALDH2)
   00380 Tryptophan metabolism
    102254132 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102254132 (ALDH2)
Enzymes [BR:myb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102254132 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 102254132
NCBI-ProteinID: XP_014403197
LinkDB All DBs
Position
Un
AA seq 422 aa AA seqDB search
MDASNRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADK
YHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTP
LTALYVANLIKEAGFPPGVVNIIPGFGPTAGAAIASHKDVDKVAFTGSTEVGRLIQVAAG
NSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYAEF
VERSVARAKSRVVGDPFDSQTEQGPQVDETQFKKILGYINTGKKEGAKLLCGGGAAADRG
YFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSMYGLAAAVFTKDLDK
ANYLSQALQAGTVWINCYDVFGAQSPFGGYKMSGNGRELGEYGLKAYTEVKTVTVKVPQK
NS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggatgcctccaacaggggtcggctgctgaaccgcctggccgacctgattgagcgggac
cggacctacctggcggccttggagaccctggataatggcaagccctatgtcatctcctac
ctggtggatttggacatggtcctcaaatgtcttcgttattatgccggctgggccgataag
taccatgggaaaaccattcccatcgatggggacttcttcagttacacccgccacgagcct
gtgggtgtgtgcgggcagatcatcccgtggaacttcccgctcctgatgcaagcgtggaaa
ctgggccctgccttggcgactgggaacgtggttgtgatgaaggtggctgagcagacgcca
ctcaccgccctctacgtggccaacttgataaaggaggctggcttcccccccggcgtggtt
aatattattcctggatttggtcccacggctggggctgccattgcctcccacaaggatgtg
gacaaagtggccttcacaggctccactgaggttggccgcctaatccaggtcgctgcgggg
aacagtaacctcaagcgggtgaccctggagctgggggggaagagccccaacatcatcatg
tcagatgctgatatggactgggctgtggagcaggcccacttcgccctgttcttcaaccag
ggccagtgctgctgtgcgggctcccggacctttgtgcaggaggatgtatatgctgagttt
gtggagcggagcgttgcccgggccaagtctcgggtggttggggacccctttgacagccag
actgagcaggggccgcaggtggatgaaactcagtttaagaagatccttggctatatcaac
actgggaagaaggagggggcgaagctgctgtgtggtggaggggcggctgctgaccgcggc
tacttcatccagcccactgtgttcggagatgtgcaagatggcatgaccatcgcaaaggag
gagatctttgggccagtgatgcagatcctgaagtttaagaccatagaggaagtcgttggg
agagcaaacaattccatgtatgggctggctgcagctgtcttcacaaaggacttggacaaa
gccaattatctgtcccaagcgctccaggctggcactgtgtggatcaactgctatgatgtg
tttggggcccagtcaccgtttggcggctacaagatgtctgggaatggccgggagctggga
gagtatggcctgaaggcatacactgaagtgaaaaccgtcacagtcaaagttcctcagaag
aactcgtaa

DBGET integrated database retrieval system