KEGG   Myotis brandtii (Brandt's bat): 102254226Help
Entry
102254226         CDS       T02920                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00480  Glutathione metabolism
myb00980  Metabolism of xenobiotics by cytochrome P450
myb00982  Drug metabolism - cytochrome P450
myb00983  Drug metabolism - other enzymes
myb01524  Platinum drug resistance
myb05200  Pathways in cancer
myb05204  Chemical carcinogenesis
myb05225  Hepatocellular carcinoma
myb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102254226 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102254226 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    102254226 (GSTO1)
   00983 Drug metabolism - other enzymes
    102254226 (GSTO1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    102254226 (GSTO1)
   05204 Chemical carcinogenesis
    102254226 (GSTO1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    102254226 (GSTO1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    102254226 (GSTO1)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    102254226 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:myb02000]
    102254226 (GSTO1)
Enzymes [BR:myb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102254226 (GSTO1)
Transporters [BR:myb02000]
 Other Transporters
  Pores ion channels [TC:1]
   102254226 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_C_3 GST_C GST_N GST_N_2 GST_C_2
Motif
Other DBs
NCBI-GeneID: 102254226
NCBI-ProteinID: XP_005878367
LinkDB All DBs
Position
Un
AA seq 246 aa AA seqDB search
MDCREATWKLRGWRGTVVEVQVADDVLDDVAVIKLRKVQKRFILFIVFYVSFRHEVVNIN
LKNKPEWFFKKNPAGLVPVLENSRGQLIYESAITCEYLDEAYPEKKLLPADPYEKACQKM
VFELFSKVPPLVGRFIRSENKEDCSDLKEEFRQEFSKLEEVLTNKKTTFFGGNSLSMIDY
LMWPWFERLEALELNECVDHTPKLKLWMAAMRKDPTVSALLIDVKTFQGFLNLYLQNSLE
ACDYGL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggattgtagggaggccacatggaagctaagaggctggcgggggactgttgtagaggtc
caggtggctgatgatgttttggacgacgtagccgtgataaagctgagaaaagtacaaaaa
cgtttcattctcttcattgtcttctatgtgtctttcaggcacgaagtcgtcaacatcaac
ctgaaaaataaacccgagtggttctttaagaagaatcccgctggtctggtgccagttctg
gaaaacagccggggtcaactgatctacgaatctgccatcacttgtgagtacctggatgaa
gcatatccagagaagaagctgttgccagctgacccctatgagaaagcgtgccaaaagatg
gtctttgagttattttctaaggtgccacctttggtaggaaggtttataagaagtgaaaat
aaggaagactgctctgacctgaaagaagaatttcgccaagaattcagcaagcttgaggag
gttctgaccaataagaagacaaccttctttggtggcaattcactttctatgattgattac
ctcatgtggccctggtttgaacgactggaagcactggagttaaatgagtgtgtagaccac
actccaaaacttaagctctggatggcagccatgaggaaagaccccacagtatcagctctc
ctcattgacgtgaaaacctttcaaggtttcttaaatctctacttgcagaacagcctggag
gcctgtgactacgggctctga

DBGET integrated database retrieval system