KEGG   Myotis brandtii (Brandt's bat): 102254448Help
Entry
102254448         CDS       T02920                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00020  Citrate cycle (TCA cycle)
myb00190  Oxidative phosphorylation
myb01100  Metabolic pathways
myb01200  Carbon metabolism
myb04714  Thermogenesis
myb04932  Non-alcoholic fatty liver disease (NAFLD)
myb05010  Alzheimer disease
myb05012  Parkinson disease
myb05016  Huntington disease
Module
myb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
myb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
myb_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102254448 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102254448 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    102254448 (SDHB)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    102254448 (SDHB)
   05012 Parkinson disease
    102254448 (SDHB)
   05016 Huntington disease
    102254448 (SDHB)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102254448 (SDHB)
Enzymes [BR:myb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102254448 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-GeneID: 102254448
NCBI-ProteinID: XP_005858790
UniProt: S7MFZ0
LinkDB All DBs
Position
Un
AA seq 268 aa AA seqDB search
MNSFRASTTYFQACRGAQTAAATAPRIKKFAIYRWDPDKTGDKPRMQTYEIDLNKCGPMV
LDALIKIKNEMDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPH
MYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDRDKLDGLYECILCACC
STSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTEERLAKLQDPFSLYRCHTIMNCTRT
CPKGLNPGKAIAEIKKMMATYKEKKASA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaactccttcagggcaagtaccacctactttcaggcctgccgaggggcccagacagct
gctgccaccgctccccgaatcaagaaatttgccatctaccgatgggatccagacaaaact
ggagataaacctcgtatgcaaacttatgaaattgatttgaataaatgtggtcctatggtg
ttggatgctttaatcaagattaagaatgaaatggattctaccttgaccttccgaagatct
tgcagggaaggcatctgtggctcctgtgcaatgaacatcaatggaggcaacactctagct
tgcacccggaggattgacaccaacctcaacaaagtctcaaaaatctaccctcttccacat
atgtatgtgataaaggatctggttcctgatttgagcaacttctatgctcagtacaaatcc
attgagccttatttgaagaagaaggatgaatcccaggaaggcaagcagcagtacctgcag
tccatagaagatcgagacaaactggatgggctgtacgagtgcatcctctgtgcctgctgc
agcaccagctgccccagctactggtggaatggagacaaatacttgggacctgcggtgctc
atgcaggcctatcgctggatgatcgactccagagacgagttcacggaggagcgcctggcc
aagctgcaggaccccttctctctctaccgctgccacaccatcatgaactgcaccaggacc
tgtcccaaggggctgaatccagggaaagctattgctgaaatcaagaaaatgatggcaacc
tacaaggaaaagaaagcttccgcttaa

DBGET integrated database retrieval system