KEGG   Myotis brandtii (Brandt's bat): 102255004Help
Entry
102255004         CDS       T02920                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00052  Galactose metabolism
myb00500  Starch and sucrose metabolism
myb01100  Metabolic pathways
myb04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102255004 (MGAM)
   00500 Starch and sucrose metabolism
    102255004 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102255004 (MGAM)
Enzymes [BR:myb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102255004 (MGAM)
    3.2.1.20  alpha-glucosidase
     102255004 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 Abhydro_lipase
Motif
Other DBs
NCBI-GeneID: 102255004
NCBI-ProteinID: XP_005875094
LinkDB All DBs
Position
Un
AA seq 1818 aa AA seqDB search
MARTKLKDFTTLELMLSALLLIVFIITIPLFVLSAKESLKSKDSGTVTAPECPVVNELER
INCIPDQSPTKATCEQRGCCWNPQGPISVPWCYYSKSHGYQVEGDLVKTNAGFTAQLKRM
PSPSLFGNDVNNVLLTAEYQTANRFHFKLTDQKSDRYEVPHEHVQAFKGNAASSQTYDVK
VSKQPFSIKVIRKSNNVILFDSSIGPLLFADQFLQLSIRLPSANVYGLGEQVHRQYRHDM
NWKTWPIFARDTTPNGDGNNLYGAQTFFLCLEDASGSSFGVFLMNSNAMEVALQPTPAIT
YRTIGGILDFYVFLGNNPEEVVQEYLELIGRPLLPAYWALGFQLSRYDYGTLDNMKEVVE
RNRAAQLPYDVQHADIDYMDARKDFTYNPVDYKGFPDFAKDLHNNGQKLVIIVDPAISIN
SSSSNPYGPYDRGLEMKIWINASDGVTPLIGEVWPGKTVFPDYTNPKCAVWWSNEFKLFH
NQVEFDGIWIDMNELSNFVDGSLSGCSTSNLNYPPFIPRVLDGYLFCKSLCMDAVQHWGK
QYDVHNLYGYSMAIATAEAVKTVFPNKRSFIITRSTFAGSGKFAAHWLGDNAATWDDLRW
SIPGMLEFNLFGIPMVGADICGFALDAPEELCRRWMQLGAFYPFARNHNGQGYKAQDPAS
FGANSLLLNSSRHYLTIRYTLLPYLYTLLYRAHSRGDTVARPLLHEFYADSNTWDVHQQF
LWGPGLLITPVLEEGAEKVMAYVPDAVWYDYETGSQLRWRKQKVEMQLPGDKIGLHLRGG
YIFPTQQPATTTVASRQNPLGLIIALDDNKEARGELFWDDGETKDTVANNVYLLCEFSVA
QNRLDVKILQSTYKDPNNLVFKEIKILGTQKPNNIVVKHNGVPTQVSPKVTYDPNRQVAL
ITGLDLVLGEAYTVEWNLTMEDVEKIDCYPDADGASEEKCLARGCAWEATTSPGAPFCYF
TKDLYSVDDIQYNSHGATAVISLKSSLYANALPSTPVNTLRVNVTYHKNDMLQFKIYDPN
NNRYEVPVPLNIPTVPSSTPESQLYNVFIKKNPFGIEIQRRSTGTVIWDSQLLGFTFNDM
FIRISTRLSSQYLYGFGENEHRTYPRNLNWHTWGMFSRDEPPGYKKNSYGVQPYYMGLEE
DGSAHGVLLLNSNAMDVTFQPLPALTYRTTGGILDFYVVLGPTPELVTQQYTELIGRPVM
VPYWSLGFQLCRYGYQNDSEIASLYDEMVAAQIPYDVQYSDIDYMERQLDFTLSPKFVGF
PALINRMKADGMRVILILDPAISGNETEKYLAFDRGVDDDVFIKAPNGDIVWGKVWPDLP
NIVINSSLDWDSQVELYRAYAAFPDFFRNSTATWWKRELKELHTNPRSPEKSLKFDGMWI
DMNEPSSFVNGAVPPGCKNASLNRPPYMPYLESRDRGLSSKTLCMESEQILPDGSRVRHY
DVHSLYGWSQTRPTYEAVQEVTGERGIVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSII
GMMEFSLFGISYTGADICGFFRDAEYEMCARWMQLGAFYPFSRNHNTIGTRRQDPVSWDD
EFVKISKSVLQTRYTLLPYLYTLMHLAHTEGSTVVRPLLHEFVSDRVTWNIDQQFLLGPA
FLVSPVLVPNARNVTAYFPRARWYDYYTGVDIKARGAWKTLPAPLDHINLHVRGGYILPW
QEPAQNTHLSRRKFLGFKVALDDKGTAEGLLFWDDGQSIDTYEKGLYYMARFSAIQNTMK
SHVIFNKYITDTNPLNLGYIEIWGVGSTSISSVSISVNGMDITPTFTYNPTLEVLKIDVT
SRNISLHNFTSLTWKSNL
NT seq 5457 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaacgaagctgaaagattttactacgttggagcttatgctcagtgctctcctg
cttattgtgtttatcatcactattcctctctttgtgctttctgccaaagagtctttgaaa
tccaaagattctggaacggttaccgcccctgagtgccccgtggtcaatgaattggagcgg
ataaactgcatcccggaccagtcacccacaaaggccacctgtgaacagcgtggctgctgc
tggaatccccagggacccatcagtgtgccctggtgctactattctaagagtcatggctac
caggtggagggtgaccttgtaaagacaaatgcaggattcacagcccagttgaaaaggatg
ccttctccatccctgtttggaaatgatgtcaacaatgtccttctcacagcggaatatcag
acagccaatcgtttccactttaagttaactgatcaaaagagtgacaggtatgaagtgcca
catgaacatgtccaagccttcaaaggaaatgctgcttcttcccagacctatgacgttaag
gtctccaaacagccatttagcatcaaagtgatcagaaaaagcaacaatgtaatcctgttt
gactcaagcattgggcctctcctgtttgctgatcagttcctgcagctctccatccgactg
cccagtgccaacgtgtatggtctgggagaacaagtgcaccggcagtaccgccatgatatg
aattggaagacctggcctatattcgccagagatacaactcctaatggggatggaaataac
ttgtatggtgcacagacattcttcctatgccttgaggatgctagtggatcgtcctttgga
gtgtttctgatgaacagcaatgccatggaggttgccctccagcccacaccagccatcact
taccgcaccattgggggcattctggacttctatgtgttcttgggaaataatccagaagaa
gtggtccaggaatatctagagctcattggacggccactcctacctgcatactgggcactt
ggatttcaactcagtcgttatgactatggaaccctagataacatgaaggaagttgtggag
agaaaccgggcagcacagctcccttacgatgttcagcatgctgatattgattatatggat
gcaaggaaggacttcacttataatccagtcgattataaaggctttcctgattttgctaag
gatttgcacaataacggacaaaaactggtcatcattgtggatccagctatctccatcaac
tcttcctcaagtaatccctatggcccgtatgacaggggtttagaaatgaagatatggatc
aatgcttcagatggagtgactccactcattggggaggtctggcctggaaaaactgtgttt
cctgattacaccaaccccaagtgtgctgtttggtggtcaaatgaatttaagcttttccac
aatcaagtggagtttgatggaatctggattgatatgaatgagctctccaactttgttgat
ggttcactttcaggatgttccacaagcaatctaaattatcctccattcattcccagagtc
ctggatgggtacctgttctgcaagtctctctgcatggatgcagtacagcactggggcaag
cagtatgatgtccacaacctgtatggctactctatggcgattgccacagcagaagctgtc
aagactgtgttccctaataagagaagcttcattataacccgttccacctttgcgggatct
ggcaagtttgcagctcattggttaggagacaatgcagccacctgggatgaccttcgatgg
tccattcctggcatgctcgagttcaatctttttggtatcccaatggtgggtgctgacata
tgtggctttgcactggatgcccctgaggagctctgcaggcggtggatgcagctgggagct
ttttacccatttgccaggaatcacaatggccaaggctacaaggcccaggatcctgcctcc
tttggagccaactctctgctgttgaattcctccaggcactaccttaccatccgctacact
ctgctgccctatctctacactctcctctatcgcgctcatagccggggggacaccgtggcc
aggccccttctgcatgagttctatgcggacagcaacacttgggatgtgcaccaacagttt
ctttgggggcctggcctcctcatcactccggttctggaagagggtgcagaaaaagtgatg
gcttatgtgcctgatgctgtctggtatgattatgagactgggagccaactaagatggagg
aagcagaaagtggaaatgcaacttcctggagacaaaattgggcttcaccttcgaggaggc
tacatcttccccacccaacagccagccacaaccactgttgccagtcgacagaaccctctt
ggtcttatcattgccctagatgacaacaaagaagcaagaggcgaacttttctgggatgat
ggggaaacaaaagatactgtggccaataatgtttatctcttatgtgagttttctgtcgcc
caaaatcgtttggatgtgaagattttgcagtcaacctacaaagatcctaataatttagta
tttaaagagattaaaatccttgggacccaaaaacctaacaacattgtagtgaaacacaat
ggtgtaccaactcaggtttctcctaaagtcacttatgatcctaaccgacaggttgccctt
atcacaggacttgatcttgtcctgggagaagcatacactgtggaatggaacctgacgatg
gaggatgtagaaaaaatagactgttatcctgatgcggatggtgcttctgaagaaaagtgt
cttgcccgtggctgtgcctgggaggcaaccacttccccaggagcccctttttgctatttc
accaaggatctatattctgttgatgatattcagtataactcacatggagccacagctgtc
atctccttaaagtcttctctttacgccaacgctttgccctcaacacctgtgaacaccctc
cgtgtgaatgtgacctaccacaagaatgacatgctgcagtttaagatttacgatcccaac
aacaatcggtatgaagtcccagtccctctcaacatacccacagttccatccagcacccct
gagagtcaactctataatgtcttcattaagaagaatccatttgggattgaaattcaacgc
aggagtacaggcaccgtgatttgggactctcagcttcttggcttcaccttcaatgacatg
ttcatccgcatctccactcgcctttcctcccagtatctttatggctttggagaaaatgag
cacagaacctatccgagaaacttgaattggcacacatgggggatgttttcccgagacgaa
cccccggggtacaagaagaattcctatggtgtccaaccctactacatgggactggaggag
gatggaagtgcccatggagtgcttctgctaaacagcaatgccatggatgtgacattccaa
cccctgcctgccttgacataccgtaccacaggaggaattctggacttttatgtggttttg
gggccaactccagaacttgtcactcagcagtacactgagttgatcggtcggccagtgatg
gttccttactggtccttggggtttcagctgtgtcgctatggataccagaacgactctgag
attgccagcttgtatgatgagatggtggctgcccagatcccctatgacgtgcagtactcg
gacatcgactacatggagcggcagctggacttcaccctcagccccaagtttgttgggttt
ccagctctgattaatcgcatgaaggccgacgggatgcgagtcatcctcattctggacccg
gccatttctggaaatgagacagagaaatatcttgcatttgatcgcggtgtggatgatgat
gtcttcatcaaagctccaaacggagacattgtctggggaaaggtctggcctgatttgccc
aatatcgttataaacagctctctagactgggacagtcaagtggagctataccgagcttac
gcagccttcccagattttttccgtaattcaactgccacctggtggaagagggagttgaaa
gaactacacaccaatccacggagtccagagaagagtttgaagttcgatggcatgtggatt
gatatgaatgaaccatcaagctttgtgaatggggcagttcctccaggttgcaagaatgcc
tctctgaaccgccctccctatatgccatatttggagtccagggacaggggtctcagcagc
aagaccctgtgcatggagagcgagcagatcctgcccgacggctcccgggtgcggcactac
gatgtgcacagcctgtacgggtggtcccagaccagacccacatacgaagctgtgcaagag
gtgacaggagaaagagggatcgtcattacccgctccacgttcccctcttctggccgctgg
gcaggacactggctgggagacaacacggctgcatgggaccagctgaagaagtctatcatt
ggcatgatggagttcagcctctttggcatatcctatacaggagcagatatctgtgggttc
tttcgagatgctgaatatgagatgtgtgctcgctggatgcaactgggggccttttacccc
ttttcaaggaaccacaacaccatcgggacaaggaggcaagaccctgtatcctgggatgat
gagtttgtgaaaatctccaaaagtgtcctgcagaccagatataccctcttgccatatctt
tacactctgatgcacctggcccacacagagggcagtactgttgtgcggcctcttctccat
gagtttgtgtcagaccgggtgacctggaacatagatcaacagttcctgctgggcccagcc
ttcctggtcagccctgtcctggtgcctaatgcaagaaatgtcactgcatacttccctaga
gcccgctggtatgattactacacgggtgtggacattaaagcaaggggagcatggaagact
ttgccagcccctcttgaccacattaatcttcatgtccgtgggggctatatcctgccctgg
caagagcctgcacagaacacccacttaagccgccggaaattcctaggcttcaaagttgcc
ttggacgataagggaactgctgaaggtttgctcttctgggatgatgggcaaagcattgac
acctatgaaaagggactctattacatggcccgcttttctgccattcagaatacgatgaag
agtcatgtaattttcaacaaatacatcacggatacaaaccctttgaatctgggctacatt
gaaatctggggagtgggcagtacctccatttccagtgtcagcatctctgtgaatggcatg
gatataacacccaccttcacctacaaccctacattagaggtgttaaaaattgatgtgacc
agcagaaacatcagcctacataatttcacttcattgacatggaaaagcaatctgtga

DBGET integrated database retrieval system