KEGG   Myotis brandtii (Brandt's bat): 102255123Help
Entry
102255123         CDS       T02920                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00250  Alanine, aspartate and glutamate metabolism
myb00410  beta-Alanine metabolism
myb00430  Taurine and hypotaurine metabolism
myb00650  Butanoate metabolism
myb01100  Metabolic pathways
myb04727  GABAergic synapse
myb04940  Type I diabetes mellitus
Module
myb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    102255123 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102255123 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102255123 (GAD1)
   00430 Taurine and hypotaurine metabolism
    102255123 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    102255123 (GAD1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    102255123 (GAD1)
Enzymes [BR:myb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102255123 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 SepSecS OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 102255123
NCBI-ProteinID: XP_005857627
LinkDB All DBs
Position
Un
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNAGADPNTANLRPTTYDTWCGVAHGCTKKLGLKICGFLQRTNSLEEK
SRLVSAFKDRQASKNLISCENSDRDGHFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDQPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
NKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPNLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADLEAKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIA
EICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERASSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFNGEPEHTNVCFWYIPQSLRSMPDSPERRERLHKVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgaccccttcttcatcggctacctcctcgaacgctggagcggaccccaat
actgccaacctgcgtcccacaacgtatgacacctggtgtggcgtggcccatggatgcacc
aaaaaactggggctcaagatttgcggcttcttgcaaaggaccaacagcctggaagagaag
agccggctggtgagcgccttcaaggacaggcaggcctccaagaacctgatttcctgcgag
aacagcgacagggatggccacttcaggcgcacggagactgatttctccaacctgtttgct
cgagatctgcttccagctaagaacggggaggagcaaactgtgcaattcctactggaggtg
gtggacatactcctcaactatgtccgcaagacgtttgatcgctccaccaaggtgctggac
ttccatcacccacaccagctgctggaaggcatggagggcttcaacttggagctctctgac
cagcctgagtccctggagcagattctggttgactgcagagacaccctgaagtatggggtc
cgcacaggtcatcctcgatttttcaatcagctctccactggactggatatcattggatta
gctggtgaatggctgacatcaactgccaataccaacatgtttacttatgaaattgctcca
gtgtttgtcctcatggagcaaataacgcttaagaagatgagagagatagttggatggtca
aataaagatggtgatgggatattttctcctgggggagccatatccaacatgtacagcatc
atggcagcgcgctacaagtacttcccagaagttaagacaaagggcatggcggctgtgccc
aacctggtcctcttcacctcagaacatagtcactactccataaaaaaggctggggctgcg
cttggctttggaactgacaatgtgattttgataaagtgcaatgaaagggggaagataatt
cctgctgatttagaggcaaaaattcttgaagccaagcaaaagggatatgttcctctttac
gtcaatgcaactgctggcacgactgtttatggagcctttgatccgatacaggagattgca
gagatatgtgagaaatataacctttggctgcatgtcgacgctgcctggggcggtgggctg
ctcatgtccaggaagcaccgtcataaactcagtggcatagaaagggccagctcggtgacc
tggaaccctcacaagatgatgggcgtgctgctgcagtgctccgccatcctcgtcaaggag
aaggggatactccaaggatgcaaccagatgtgtgcaggctacctcttccagccagacaag
caatatgatgtctcctatgacactggggacaaggcaattcagtgtggccgtcacgtggac
attttcaagttctggctgatgtggaaagcaaagggaacagtgggatttgaaaatcagatc
aacaaatgcttggaactggctgaatacctctatgccaaaattaaaaacagagaagaattt
gagatggttttcaatggtgagcctgagcacacaaatgtctgtttctggtacatcccacaa
agcctccggagcatgccggacagccctgagcgacgggaaagactccacaaggtggctccc
aaaatcaaagccctgatgatggagtctggcacgaccatggttggctaccagcctcagggg
gacaaggccaacttcttccggatggtcatctcgaacccggccgccacccagtctgacatc
gacttcctcattgaggagatagaaagactgggccaggatctgtag

DBGET integrated database retrieval system