KEGG   Myotis brandtii (Brandt's bat): 102255326
Entry
102255326         CDS       T02920                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb01521  EGFR tyrosine kinase inhibitor resistance
myb04010  MAPK signaling pathway
myb04014  Ras signaling pathway
myb04015  Rap1 signaling pathway
myb04020  Calcium signaling pathway
myb04072  Phospholipase D signaling pathway
myb04144  Endocytosis
myb04151  PI3K-Akt signaling pathway
myb04510  Focal adhesion
myb04540  Gap junction
myb04630  JAK-STAT signaling pathway
myb04810  Regulation of actin cytoskeleton
myb05163  Human cytomegalovirus infection
myb05200  Pathways in cancer
myb05206  MicroRNAs in cancer
myb05214  Glioma
myb05215  Prostate cancer
myb05218  Melanoma
myb05230  Central carbon metabolism in cancer
myb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102255326 (PDGFRA)
   04014 Ras signaling pathway
    102255326 (PDGFRA)
   04015 Rap1 signaling pathway
    102255326 (PDGFRA)
   04630 JAK-STAT signaling pathway
    102255326 (PDGFRA)
   04020 Calcium signaling pathway
    102255326 (PDGFRA)
   04072 Phospholipase D signaling pathway
    102255326 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    102255326 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102255326 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102255326 (PDGFRA)
   04540 Gap junction
    102255326 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102255326 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102255326 (PDGFRA)
   05206 MicroRNAs in cancer
    102255326 (PDGFRA)
   05230 Central carbon metabolism in cancer
    102255326 (PDGFRA)
   05231 Choline metabolism in cancer
    102255326 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    102255326 (PDGFRA)
   05218 Melanoma
    102255326 (PDGFRA)
   05215 Prostate cancer
    102255326 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102255326 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102255326 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myb01001]
    102255326 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:myb04090]
    102255326 (PDGFRA)
Enzymes [BR:myb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102255326 (PDGFRA)
Protein kinases [BR:myb01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102255326 (PDGFRA)
CD molecules [BR:myb04090]
 Proteins
  102255326 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE C1-set C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 102255326
NCBI-ProteinID: XP_005877218
LinkDB
Position
Un
AA seq 1102 aa
MTRNGEAWFQFSGAMGTSHLALLVLGCLLAGPSLILCQLSLPSILPNENEKVVQLNSSFS
LRCFGESEVTWQYPMSDEDPNVRIRNEENNSGLFVTVLEVANASAAHTGLYTCYYNHTQT
EENEIEGSHIYIYVPDPDVVFVPLGMTDYLVIVENDDFAIIPCRTTDPQTPVTLLSSDGV
VLADYDSRQGFNGTFSGGPYVCEAIVKGKKFHSIPFNIYSVKATSELDLELEAPKTVYMA
GETIVLTCIVLNNEVVDFQWTYPGEVKNKGVVMLEEIKDPSIKLVHTLMVPKATVKDSGD
YECIARLATREVKEMKKVTIAVHEKGFIEIQPGFSQLEAVNLHEVKHFVVDVQAYPPPRI
SWLKDNLTLIENLTEITTDIEKVQEIRYRSRLKLIRAKEEDSGHYTIVVQNEDDMKSYTF
ELLTQVPASILDLVDDHHGSTGGQTVRCTAAGTPLPEIEWMICKDIKKCNNETSWAILAN
NISNIITEVYRQDRSRVEGRVTFAKVEETIAVRCLAKNLLGVENRELKLVAPTLRSELTV
AAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWE
FPRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKI
MTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDI
FGLNPTDESTRSYVVLSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPAS
YKKKSMLDSEVKNLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLA
QGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWE
IFSLGGTPYPGMMVDSTFYNKIKSGYRMAKPDHATSEIYEIMVKCWNSEPEKRPSFYHLR
EIVENLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDADNAYIGVTYKNEEDKLKDWEGGL
DEQRLSADSGYIIPLPDIDPIPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETI
EDIDMMDDIGIDSSDLVEDSFL
NT seq 3309 nt   +upstreamnt  +downstreamnt
atgactcggaatggagaagcttggttccagttttccggagctatggggacttcccatctg
gcactcctggtcctgggctgtctcctcgcagggccgagcctaatcctctgccagctttca
ctaccctctatcctcccaaacgaaaatgaaaaggttgtgcagctgaattcatccttttct
ctgagatgctttggggagagtgaagtgacctggcagtaccccatgtctgacgaggacccc
aatgtgaggatcagaaacgaggagaacaacagtggccttttcgtgacggtgctggaagtg
gccaacgcctcggcggctcacacggggttgtacacttgctattacaaccacacgcagaca
gaagaaaacgagattgaaggcagtcacatttacatctacgtgccagacccagatgtagtc
ttcgtgcctctgggaatgacagactatttagtcattgtggagaatgacgattttgccatc
ataccttgtcgcacgactgatcctcagactccggtgaccttgctcagcagtgacggggtg
gtcctcgccgactatgacagccggcagggcttcaacgggaccttctcgggtgggccctat
gtctgcgaggccatcgtcaaggggaagaagttccactccattccatttaacatttattct
gtcaaagcaacatcagaactcgatctagaattggaagccccgaaaactgtctacatggca
ggggaaaccattgtgctcacctgcatcgtcttgaacaacgaggtggttgactttcagtgg
acttaccctggagaagtgaaaaacaaaggcgtcgtaatgctggaggaaatcaaggaccca
tccatcaaactggtgcacaccctgatggtccccaaggccacggtgaaagacagtggagat
tacgaatgtatcgcccgcctggccaccagggaggtcaaagagatgaagaaagtcaccatt
gctgtccacgagaaagggttcattgaaatccagcccggcttcagccagctggaagctgtc
aacctgcatgaagtcaaacattttgtggtggacgtgcaggcctacccgccgccccggata
tcctggctgaaggacaacctgactctgatcgaaaacctcaccgagatcaccaccgacata
gaaaaggtccaggagatcaggtaccgaagtagattaaagctgatccgtgctaaggaggaa
gacagtggccattacactattgtagttcaaaatgaagatgacatgaagagctacactttt
gaactcttaactcaagttcccgcatctattctggacttggtcgacgaccaccatggctcc
acggggggacagaccgtgagatgcacagctgcagggacacctcttcctgaaattgagtgg
atgatttgcaaggatattaagaaatgtaataatgagacttcatgggcgattttggccaac
aacatctcaaacatcatcacggaggtctaccgccaggacaggagtagggtggagggccgg
gtgacgttcgccaaagtggaggagaccattgcggttcgatgtctggctaagaatctcctt
ggtgttgagaaccgagagctgaagctggtggctcccactctgcgttctgagctcacggtg
gcagccgcagtcctggtgctattggtgattgtgatcatctcactgattgtcctcgttgtc
atttggaaacagaaaccaaggtatgaaattcgttggagggtcattgaatcaatcagccct
gatggacacgaatatatttatgtggacccgatgcagctgccttatgactcgagatgggag
tttccaagagacggactagtgctgggtcgtatcctgggatctggtgcgtttgggaaggtg
gttgaaggaactgcctacggattaagccggtcccaaccggtcatgaaagtagcagtgaag
atgcttaaacccacagccagatccagtgaaaaacaagctctcatgtctgaactgaagata
atgacccacctggggccgcatttaaacattgtcaacctgctgggcgcctgtaccaagtca
ggccccatttacatcatcactgaatactgcttctatggggatttggtcaactacttgcat
aagaatagggacagcttcctgagccaccacccagagaagccaaagaaagagctggacatc
tttggattaaatcctaccgatgaaagcacacggagttacgttgttttatcttttgaaaac
aatggtgactacatggacatgaagcaagctgacaccacacagtacgtccccatgctggaa
aggaaagaggtttctaaatactcggacatccagaggtcgctgtatgaccgcccagcctca
tacaagaagaagtctatgttagactcagaagtcaaaaacctcctttcggatgataactcg
gaaggcctgactttgttggatttattgagcttcacctatcaagttgctcgaggaatggag
tttttggcttcaaagaattgtgtccaccgggacctggccgctcgcaacgtcctcctggca
caagggaaaatcgtgaagatctgcgactttggcctggccagagacatcatgcatgactcg
aactacgtatcgaaaggcagcaccttcctccctgtgaagtggatggctcctgagagcatc
ttcgacaacctctacaccacgctgagcgacgtctggtcttacggcattctgctctgggag
atcttttcccttggtggcacaccctaccctggcatgatggtggattctactttctacaat
aagatcaagagtgggtaccggatggccaagcctgaccacgccaccagtgaaatctacgag
atcatggtgaagtgctggaacagtgagccggagaagagaccctccttttaccacctgaga
gagattgtggagaacctgctgcctggacagtataaaaagagttatgaaaagattcacctg
gatttcctgaagagcgaccatcctgctgtggcgcgcatgcgagtggatgctgacaacgcc
tacattggcgtcacctacaaaaacgaggaggacaagctgaaggactgggagggtggcctg
gacgagcagaggctgagtgctgacagcggctacatcatccctctgcctgacatcgacccc
attcctgaggaggaagacctgggcaagaggaacagacacagctcgcagacctctgaagag
agtgccattgagacaggttccagcagttccaccttcatcaagagagaggacgagaccatt
gaggacatcgacatgatggatgacattggcatagactcctcagacctggtggaggacagc
ttcctttaa

DBGET integrated database retrieval system