KEGG   Myotis brandtii (Brandt's bat): 102255810Help
Entry
102255810         CDS       T02920                                 

Definition
(RefSeq) cationic trypsin-3
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04080  Neuroactive ligand-receptor interaction
myb04972  Pancreatic secretion
myb04974  Protein digestion and absorption
myb05164  Influenza A
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102255810
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102255810
   04974 Protein digestion and absorption
    102255810
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    102255810
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:myb01002]
    102255810
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:myb04147]
    102255810
Enzymes [BR:myb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102255810
Peptidases [BR:myb01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102255810
Exosome [BR:myb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102255810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 102255810
NCBI-ProteinID: XP_005875097
UniProt: S7PQQ8
LinkDB All DBs
Position
Un
AA seq 246 aa AA seqDB search
MKAFIFLALLGAAVAFPDDDDDKIVGGYTCRKNSIPYQVSLNAGYHFCGGALINDQWVVS
AAHCYKSRIQVRLGEHNIEVVEGNEQFINAAKIIRHPKYNARTIDNDIMLIKLSSPATIS
SRVATISLPGTCADVGTQCLISGWGNTQSVGTNYPELLQCLDAPVLSDSVCRKAYPGQIT
NNMMCLGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAMKGKPGVYTKVCNYVRWIQ
DTMAAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccttcatcttccttgctctcctgggagctgctgttgctttccccgatgatgat
gatgacaagattgtcgggggctacacctgccgaaagaattccatcccctaccaggtgtcc
ctgaacgctggctaccacttctgtggtggcgctctcatcaatgaccagtgggtggtgtcc
gctgctcactgctacaagtctcgaatccaggtgcgtctgggagagcacaacattgaagtc
gttgagggcaatgagcagttcattaatgcagccaagatcatccgccaccccaaatacaat
gcccgcaccatcgataatgacatcatgctgattaagctgagctcacctgccaccatcagc
tctcgcgtcgccactatttctctgccaggaacttgtgcagatgttggtacccagtgtctc
atctctggctggggcaacacccagagcgtcggcactaactaccctgagctcctgcagtgc
ctggatgctcccgtcctctctgacagtgtttgccgcaaagcctacccaggccagatcacc
aacaacatgatgtgtctgggcttcctggagggtggaaaggactcttgccagggtgactct
ggtggacctgtggtctgcaatggacagctccagggcattgtctcttggggctatggctgt
gctatgaagggcaaacctggtgtctacaccaaggtctgcaactacgtgagatggattcag
gacaccatggctgccaactaa

DBGET integrated database retrieval system