KEGG   Myotis brandtii (Brandt's bat): 102255838Help
Entry
102255838         CDS       T02920                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb03030  DNA replication
myb03410  Base excision repair
myb03420  Nucleotide excision repair
myb03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:myb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    102255838 (LIG1)
   03410 Base excision repair
    102255838 (LIG1)
   03420 Nucleotide excision repair
    102255838 (LIG1)
   03430 Mismatch repair
    102255838 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:myb03032]
    102255838 (LIG1)
   03400 DNA repair and recombination proteins [BR:myb03400]
    102255838 (LIG1)
Enzymes [BR:myb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102255838 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     102255838 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     102255838 (LIG1)
DNA replication proteins [BR:myb03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    102255838 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     102255838 (LIG1)
DNA repair and recombination proteins [BR:myb03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     102255838 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     102255838 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     102255838 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2 DDR
Motif
Other DBs
NCBI-GeneID: 102255838
NCBI-ProteinID: XP_014405904
LinkDB All DBs
Position
Un
AA seq 947 aa AA seqDB search
MQRSIMSFFHPKKEGKAKKPEETPSSARETEPPPKVALKERNRVVPESDSPVKRSGRKTA
RVLCSEGEEEEDDEAITSPKGQKPAPSSPQVSPPGPVTSPASSPSLSSTSPAATISPSGI
PKRLTARKQFSKRKIQGVLEEHSTDQGQEAKRKKVEEEAETPTENLPEAEGAKEKKAEEG
DLPMMPPEPQNACKAEPPTESGSEPMVVVKQEPQDEEQAKPPPRAPRMLSSFFTPRKPAI
KKEVKEEGPGTPRKEASKGPLDPSSYNPAKKNYHPVQDACWMQGQKVPYLAVARTFEKIE
EVSARLRMVETLSNLLRSVVALSPPDLLPILYLSLNCLGPPQQGLELGVGDGVLLKAVAQ
ATGRQLELVRAEAAETGDVGLVAENSRSTQRLMLPPPALTASGVLAKFRDIARLTGNAST
ARKMDIIKGLFVACRHSEARFITRALSGRLRLGLAEQSVLAALAQAVSLTPPGQEFPPAV
VDAGKGKTAEARKTWLEEQGMILKQTFCQVPDLDRIVPVLLEHGLEGLPEHCKLSPGVPL
KPMLAHPTRGVSEVLKRFDEAAFTCEYKYDGQRAQGGEVKIFSRNQEDNTGKYPDIISRI
PKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDAAEIQVQVCLYAFDLIYL
NGEVQWWDMGVERRGWHMEALIQLAALTIFLQIILDDLSLVREPLSRRRQLLRENFVETE
GEFVFATSLDTKDMDQIAEFLEQSVKDSCEGLMVKTLDIDATYEIAKRSHNWLKLKKDYL
DGVGDTLDLVVIGAYLGRGKRAGRYGGFLLAAYDQESEELQLGTGFSDEELEEYHQTLQA
RVLPTPRSYVRADGAVAPDHWLEPSIVWEVRCADLSLSPIYPAARGLVDSEKGISLRFPR
FVRVREDKTPEEATTSAQVAWLYKRQSQIQNQEDTDQDSDPDLECFY
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcatcatgtcgtttttccaccccaagaaagagggcaaagcaaagaagcca
gaggagacgcccagcagcgccagagagaccgagccccctccaaaggtggcgctgaaggag
cggaacagagtggtgcctgagagcgactctccggtgaagaggtcgggcaggaagacggcc
cgggtcctgtgtagcgaaggggaggaggaggaggacgatgaagccatcacgtcccccaaa
ggccagaagcctgcccccagctctccacaagtctcccctcccggtcctgtcacgtcccct
gcgagcagcccttccctctccagcacctctccagcagcgaccatctccccgtcagggatc
ccgaagcggctcacagctcgaaagcagttttctaaacggaagattcagggtgtcctagaa
gagcacagcacggaccagggccaagaagccaagaggaagaaggtggaggaagaagcagag
accccaacagaaaacctcccagaggcagaaggggccaaagagaagaaagcagaagagggg
gacctgcccatgatgccccccgagccccaaaacgcctgcaaagctgagccgccgacagaa
agcggttccgagcccatggtggtggtgaagcaggagccccaggatgaggagcaggccaag
ccgccccccagagctcccaggatgctcagcagtttcttcaccccccggaagccggcaatc
aaaaaggaagtgaaagaagaggggcctggcaccccaagaaaggaggcgtccaagggcccc
ctggacccatccagctacaaccctgccaagaaaaactaccatcccgtccaggacgcgtgc
tggatgcagggccagaaggtcccttacctggcggtggcccggacgtttgagaagatcgag
gaggtttctgctcggctccggatggtggagacgctgagcaacttgcttcgctccgtggtg
gccctgtcgcccccagacctcctccccatcctctacctcagcctcaactgcctcgggccc
ccccagcagggcctggagctcggcgtcggggatggtgtccttctcaaggcggtggcccag
gccacaggtcggcagctcgagttggtgcgggccgaggcagccgagacgggcgacgtgggg
ctggtggccgagaacagccgcagcacccagagactcatgctgcccccacccgccctcacc
gcctctggggtcctcgccaaattccgagacatcgcccggctcactggcaacgcttccaca
gccaggaagatggacatcattaaaggcctgtttgtggcctgccgccattcagaagcccga
ttcatcaccagagccctgagtggacggctgcgcctcgggctggcagagcagtcggtgctg
gccgccctcgcccaggccgtgagcctcacgcctccaggccaagaattccccccggccgtg
gtggatgctgggaagggcaagacagcagaggccagaaagacgtggctggaggagcaaggc
atgatcctgaagcagacgttctgccaggtgcctgacctggaccggatcgtcccggtgctg
ctggaacatggcctggaggggctcccggagcactgcaagctgagtccaggggtccccctg
aaaccaatgttggcccaccccacccggggcgtcagcgaggtcctgaagcgcttcgatgag
gcagctttcacctgcgagtacaaatacgacgggcagagggcccagggcggggaggtgaag
atcttcagcaggaatcaggaagacaataccggaaagtacccggacatcatcagccgcatc
cccaagattaaactcccgtcagtcacatctttcatcctggacacagaagccgtggcttgg
gaccgggagaagaagcagatacagccgttccaagtgctcaccacccgcaaacgcaaggag
gtggatgcagcggagatccaggtgcaggtgtgtttgtacgccttcgacctcatctacctc
aacggagaggttcagtggtgggacatgggcgtggagcgccggggctggcacatggaagct
ttgatacaattagctgccctcaccatcttcctccagataatccttgacgatctgtccctg
gtccgtgagcccctttcccgacgccggcagctgctccgggagaacttcgtggagacggag
ggcgagtttgtcttcgccacctccctggacaccaaggacatggaccagatcgcggagttc
ttggagcagtcggtgaaagactcctgcgaggggctgatggtgaaaaccctggacatcgat
gccacctacgagatcgccaagagatcacacaactggctcaagctgaagaaggactacctg
gacggcgtgggggacaccctggatctcgtggtgatcggcgcctacctgggccgggggaag
cgggccggccgctacgggggcttcctgctggccgcctacgaccaggagagcgaggagctg
cagctgggaaccggcttcagcgacgaggagctggaggagtatcaccagaccctgcaggcc
cgggtgctgcccacccctcgctcctatgtccgggcagacggcgccgtggccccggaccac
tggctggagcccagcatcgtgtgggaggtcaggtgcgcggacctctccctctcgcccatc
taccccgctgcccgcggcctggtggacagtgagaaggggatctcccttcgcttccctcgg
tttgttcgcgtccgtgaagacaagacgccggaggaggccaccaccagtgcccaggtggcc
tggctgtacaagaggcagagtcagattcagaaccaggaggacacagaccaagactcggac
ccggacctggagtgtttctactag

DBGET integrated database retrieval system