KEGG   Myotis brandtii (Brandt's bat): 102256157
Entry
102256157         CDS       T02920                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04010  MAPK signaling pathway
myb04014  Ras signaling pathway
myb04015  Rap1 signaling pathway
myb04151  PI3K-Akt signaling pathway
myb04390  Hippo signaling pathway
myb04810  Regulation of actin cytoskeleton
myb05200  Pathways in cancer
myb05218  Melanoma
myb05224  Breast cancer
myb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102256157 (FGF1)
   04014 Ras signaling pathway
    102256157 (FGF1)
   04015 Rap1 signaling pathway
    102256157 (FGF1)
   04390 Hippo signaling pathway
    102256157 (FGF1)
   04151 PI3K-Akt signaling pathway
    102256157 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102256157 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102256157 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    102256157 (FGF1)
   05218 Melanoma
    102256157 (FGF1)
   05224 Breast cancer
    102256157 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:myb04052]
    102256157 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:myb00536]
    102256157 (FGF1)
Cytokines and growth factors [BR:myb04052]
 Growth factors
  Growth factors (RTK binding)
   102256157 (FGF1)
Glycosaminoglycan binding proteins [BR:myb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102256157 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 102256157
NCBI-ProteinID: XP_005881156
UniProt: S7NKF2
LinkDB
Position
Un
AA seq 155 aa
MAEGEVTTFTALTERFNLPLENYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTESGQYLAMDSDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgagggggaagtcaccacgttcacggccctgaccgagaggttcaatctgcctctg
gagaactacaagaagcccaagcttctctactgcagcaacgggggccacttcctgcggatc
ctcccagacggcaccgtggacgggacgagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagcaccgagagtggccagtactta
gccatggactccgacgggcttttgtacggctcacaaacacccaatgaggaatgtttgttc
ctggaaaggctggaggagaaccactacaacacctacacgtccaagaagcacgcagaaaag
aattggttcgttgggctcaagaagaacggaagctgcaagcgtggtcctcggacgcattat
ggccagaaagcaatcttgtttctccccctgccagtctcctccgattaa

DBGET integrated database retrieval system