KEGG   Myotis brandtii (Brandt's bat): 102257472Help
Entry
102257472         CDS       T02920                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  anaphase-promoting complex subunit 8
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04110  Cell cycle
myb04114  Oocyte meiosis
myb04120  Ubiquitin mediated proteolysis
myb04914  Progesterone-mediated oocyte maturation
myb05166  HTLV-I infection
Module
myb_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:myb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102257472 (CDC23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102257472 (CDC23)
   04114 Oocyte meiosis
    102257472 (CDC23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102257472 (CDC23)
 09160 Human Diseases
  09167 Infectious diseases
   05166 HTLV-I infection
    102257472 (CDC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:myb04121]
    102257472 (CDC23)
   03036 Chromosome and associated proteins [BR:myb03036]
    102257472 (CDC23)
Ubiquitin system [BR:myb04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     102257472 (CDC23)
Chromosome and associated proteins [BR:myb03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    102257472 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_7 TPR_16 ANAPC3 TPR_17 TPR_12 TPR_9 DUF772 TPR_15
Motif
Other DBs
NCBI-GeneID: 102257472
NCBI-ProteinID: XP_005881078
UniProt: S7NHN2
LinkDB All DBs
Position
Un
AA seq 597 aa AA seqDB search
MAASPSVVSVALTAPGVPILSASGDFSNLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLVELQPPPPMTEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYTCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGETPSAEMPAPFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgagcccctctgtagtctctgtggccctgacggctccgggggtacccatcttg
tcagctagtggcgatttctcaaacttgcgggaaattaaaaagcagctgctacttatcgct
ggccttacccgagagcggggcctactgcacagcagcaaatggtccgcggagttggccttc
tccctcccggcgttgcctctagtcgagctgcagccgcctccgcctatgacagaggaagat
gcccaggatatggatgcttacaccctggccaaagcctactttgatgttaaagagtacgat
cgggcagcacatttcctgcatggttgcaatagcaagaaagcctatttcctgtacatgtat
tctagatacctgtctggagaaaagaagaaggatgatgaaacagttgatagcctaggcccc
ctggaaaaaggacaagtaaaaaatgaggctcttagagaattgagagtggagctcagcaaa
aagcaccaagctcgggaacttgatggttttggcctttatctgtatggtgttgtgcttcga
aaactggacttggtgaaagaggccattgatgtatttgtggaggctactcatgttttacct
ttgcattggggagcctggctagaactctgtaacttgattacagacaaagagatgctgaag
ttcctgtctttgccagacacctggatgaaagagttttttctggctcatatatacacagaa
ttgcagttgatagaggaggccctgcaaaagtatcagaatctcattgatgtgggcttttct
aagagctcttatattgtttcccaaattgcagttgcctatcacaatatcagagatattgat
aaagccctctctatttttaatgagctaaggaaacaagacccttataggattgagaatatg
gatacattctccaaccttctttatgtcaggagcatgaaatctgagttgagttatctggct
cacaacctctgtgagattgataaatatcgtgtagaaacttgctgtgtaattggcaattat
tatagtttgcgttctcagcatgagaaagcagccttatatttccaaagagccttgaaattg
aatcctcggtatcttggggcctggacactaatgggacatgagtacatggaaatgaagaac
acatctgctgctattcaggcttacagacatgccattgaggtaaataagcgggactacaga
gcctggtatggccttgggcagacctatgaaatccttaagatgccattttactgcctttat
tattatagacgggcccatcagcttcggcccaatgactctcgtatgctggttgctttagga
gaatgttacgagaaactcaatcaacttgtggaagccaaaaagtgttattggcgagcttac
gctgtgggagatgtggagaaaatggctctggtgaaacttgcaaagcttcatgaacagttg
actgagtcagaacaggctgctcaatgttacatcaaatatatccaagatatctatacctgt
ggggaaatagtggaacacttggaggaaagcacagctttccgctatctggcccagtactat
tttaagtgcaaactgtgggatgaagcttcaacttgtgcccaaaagtgttgtgcattcaat
gatacccgggaagaaggtaaggccttgctccggcaaatcctgcagcttcggaaccaagga
gagactccttccgctgagatgcctgcaccctttttcctacctgcgtcactgtctgctaac
aatactcctacacgcagagtttctccactcaacctgtcttcagtcacaccatag

DBGET integrated database retrieval system