KEGG   Myotis brandtii (Brandt's bat): 102257639
Entry
102257639         CDS       T02920                                 

Gene name
NLRP4
Definition
(RefSeq) NLR family pyrin domain containing 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
KEGG Orthology (KO) [BR:myb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:myb04131]
    102257639 (NLRP4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:myb04054]
    102257639 (NLRP4)
Membrane trafficking [BR:myb04131]
 Autophagy
  Other autophagy associated proteins
   Others
    102257639 (NLRP4)
Pattern recognition receptors [BR:myb04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   102257639 (NLRP4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 AAA_25 AAA_22 VirE SRP54 ResIII AAA_30 DUF1722 NTPase_1 AAA_14 DAP3 TrwB_AAD_bind AAA_18 AAA_7 AAA_28 AAA_19 CbiA
Other DBs
NCBI-GeneID: 102257639
NCBI-ProteinID: XP_014403016
LinkDB
Position
Un
AA seq 986 aa
MASSFFSEFGLLWYLKELSRNEFKIFKEKLKQETLHLGLQQIPWANVKKATREVLANLLV
KHYKETQAWDVTFTIFQKINREDLCQKAKKECTGYTKTYRAHIKEKFSEAWFRDTVMHCY
GYVDKELTQKERKCLEFLFAPKEPRRRTVILTGAQGVGKTTVLAKLMLAWAEDTLYQQKF
SYVFYLCCREVRQVTVTSLAALICRDWSDSLTPIGEITSEPERLLFILDGFEELMYDLNE
PESDLCSDWMAQRPVQVVLSSLLRKKMLPESSLLVATVPSYARFIKDRLGHPEIQTLQGF
TEDEMLLSFSFIFRKGWRGVKAFHFIRSNKQLFSMCQIPVLCWAACTCLKQEMERGKDLA
MTCRRTISLYSSFVLNLFTPKGARCPDEQSRVRLKGLCSLAAEGMWSNTFVFGEEDLRRN
GLAASDIPALLDIKALRKGGGTENASYTFLHLCIQEVCAALFYFIKSHADHPIPAVGCAE
AVLATHLKRTKAQWIFLPSFLFGLLNENEQRKLGAFFGAHLCQEEVRQAVEQHLWGVSQS
EHLRGQLNFLMLCYCLFEMEDEAFVRWAVDLFQEVSFLITDLMDLIVLSYCLTRCSALRK
LDFSIQNVFIDTSMXVHSMTFCYQLLYWNDICSVLTANENLRELQVSDSNLPGPALVTLS
NHLKHPRCRLQMLKMNNVSFSAESWFFFEVFTQSPVLKHLDLSDTRISHDDFKLLCNALN
NPACNIESLLLVECGLLADDCEGFKEVLMRNTKLKILDLSYNCLGNGLSLLCEALCLPAC
ALRGLALIDCRLREPCWERLRDVVLGNRNLTHLDLSTNGLEDKDLNLLSEALKQPSCYLK
SLSLFNCLITANGCQDLASILTGNPNLINLQIGHNNIEDDGVRLLCEALLHPNCHLENLG
LDACGLTSACCEDLASVLTGSRCLKKLNLAGNPLDHHGSAAVCAALRHPECGLQTLELEK
AEFDEETQELLVAEEERNPCLTITHR
NT seq 2961 nt   +upstreamnt  +downstreamnt
atggcatcatctttcttttctgaatttggccttctgtggtacctgaaggagctcagcagg
aacgagtttaagatttttaaggagaagctcaagcaagaaactctgcacctgggactccag
cagatcccctgggctaacgtgaagaaggcgacccgggaagtcctggcaaacctgctggtc
aagcattataaggaaacacaagcctgggatgtgactttcaccatcttccagaagatcaac
cgggaggacctctgccagaaggccaagaaggagtgtacaggatacacaaagacatatcgc
gctcacatcaaggagaaattcagcgaggcgtggttccgagacactgtcatgcattgttat
ggatacgttgacaaggagctcacccagaaagagcgcaaatgcctggagtttctttttgct
cccaaggagcccaggagacggacagtgatccttacaggggctcagggggtcgggaagacg
acggtcctggcgaagctgatgctggcctgggcagaggacacgctctaccagcagaagttc
tcctacgtattctacctctgctgccgggaggtgaggcaggtgacagtgaccagcttggcc
gccttgatctgtagagactggtccgactccctcacccccattggggagatcacctccgaa
ccggagaggctcttgttcatcctcgacggctttgaagagttgatgtatgacttgaatgag
cccgagtcagatctgtgcagcgattggatggctcagcggcccgtccaggtggtcctgagc
agcctgctgaggaagaagatgctcccagagtcctccctgctcgtggccacggtgccctcg
tacgcacggttcatcaaggacaggctggggcacccagagatccaaacgctccagggattc
acggaggacgagatgctgctgagtttcagcttcatattccggaaggggtggagaggcgtc
aaagccttccatttcatcagaagcaacaagcagctgttttccatgtgccagatccccgtc
ctgtgctgggccgcgtgcacttgtctgaagcaggagatggaacgagggaaagacctggcg
atgacctgccggcggaccatctcgctgtattcctcgtttgtcttgaacctgttcacgccc
aagggggctcgctgtccggatgagcaaagccgagtccggctgaagggcttgtgttccctg
gctgccgagggcatgtggagcaacacgtttgtgttcggggaggaggatctccggagaaac
gggttggcggcctctgacatccctgcactgctggacatcaaggcccttcgcaagggcggg
ggcaccgagaacgcttcgtacacgttcctccacttgtgcatccaggaggtctgcgccgcc
ctgttctacttcatcaagagccacgccgaccacccgatcccggcggtgggctgtgccgag
gctgtgctggcgacccatttgaagagaaccaaggcccagtggatctttctgccatctttc
ctgtttggccttttgaacgaaaacgaacagaggaagctgggtgccttctttggcgcccac
ctgtgccaggaggaggtacggcaggcagttgagcagcacctatggggcgtcagccagagt
gagcaccttcgggggcagctgaatttcctgatgttgtgttactgtctgttcgagatggag
gacgaggccttcgtgcggtgggcggtggacctgttccaagaggtgtcctttttgatcacc
gacctgatggacttgatagtcctttcctactgcttgacacgctgttcggccttgaggaaa
cttgacttttccatccaaaatgtcttcatagacacctccatgtgagtccattcaatgact
ttctgttaccagttactctattggaatgacatctgctccgtgctcacggcaaatgagaac
ctcagagaactccaagtgagtgacagtaacctccccgggccggccctcgtaacactgagc
aatcatctgaagcaccccaggtgtcgccttcagatgcttaagatgaataacgtttccttc
tccgctgaaagctggtttttctttgaggtgttcacccagagcccagttttaaaacacctg
gatctcagtgacacaagaatctcccatgatgacttcaagttgctgtgtaatgccttgaac
aatcctgcgtgcaacatagagagtttactgctggtggagtgtggcctcttagcggatgat
tgtgaaggattcaaggaggtcctgatgaggaacacgaagctgaagattctggacttatcc
tacaactgcttgggcaacgggctgtccctcttgtgtgaagccctgtgcctcccagcttgt
gctctgaggggcttggcgttaattgactgccgcctcagggaaccttgctgggaacgtctc
cgtgacgttgtcctgggtaacaggaacttgacccacctagacctcagcacaaatggcctg
gaagacaaagacttgaaccttctcagtgaggccttgaaacagccatcctgctacctgaag
tcactaagtttgttcaactgtctcataactgccaatggctgtcaggacctcgcctccatc
ctcacgggaaacccaaacctgataaatctgcaaattgggcacaacaacatagaagatgac
ggtgtgcggctgctgtgcgaagctctgctgcatcccaactgccacttagagaatcttggg
ctggacgcgtgcgggttgaccagcgcctgctgtgaggacctcgcttctgttctcacgggc
agccgatgcctgaagaaactcaacctggctgggaaccccttggaccaccacgggtcagct
gctgtgtgcgccgccctgaggcacccggagtgcgggctgcagactctggagctggagaaa
gctgaatttgacgaggaaacccaggaactcctggtggccgaggaagagagaaacccctgc
ttgaccatcacccatcggtga

DBGET integrated database retrieval system