KEGG   Myotis brandtii (Brandt's bat): 102258673
Entry
102258673         CDS       T02920                                 

Gene name
NR3C1
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 1
  KO
K05771  glucocorticoid receptor
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102258673 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:myb03000]
    102258673 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:myb03310]
    102258673 (NR3C1)
Transcription factors [BR:myb03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    102258673 (NR3C1)
Nuclear receptors [BR:myb03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   102258673 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 SCA7 Pheromone
Other DBs
NCBI-GeneID: 102258673
NCBI-ProteinID: XP_005881165
LinkDB
Position
Un
AA seq 778 aa
MDSKESLGSPSREEIPSSELVGERGKVMDFYKTLRGGATVKVSASPPSLAAAPLSDSKQL
RLLVDFPKGSGSNAQQPDLSQAVSLSMGLYMGETETKVMGNDLGFPQPGQISLSSGETDF
RLLEESIANLSKSTSVPENPKSSASATVSVAPEEEFSKTHTDASSEQQNLKSQTGTNGGN
VKLYTADQRAFDILQDLEFPSGSPGKEMNESPWRPDLLIDENCLLSPLGGEEDPFLLEGN
SNEDCKPLVLPDTKPKIKDNGDLILPSPSSVTLPQVKTEKEEDFIELCTPGVIKQERLGP
VYCQESFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPVFNVIPPIPV
GSENWNRCPGSGDDNLTSLGTLNFPGRSVFSNGYSSPGMRPDVSSPPASSSAASGPPPKL
CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIRRKNCPACRYR
KCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENSANKTIVPATLPQLTPTLVSLLEVI
EPEVLYAGYDCSSPDSAWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYS
WMFLMAFALGWRSYRQSNANMLCFAPDLVINEQRMSLPFMYDQCKHMLYVSSELQRLQVS
YEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLT
KLLDSMHEVVENLLHYCFQTFLDKSMSIEFPEMLAEIITNQLPKYSSGNIKKLLFHQK
NT seq 2337 nt   +upstreamnt  +downstreamnt
atggactcaaaggaatccttaggctcccccagtagagaagaaatccccagcagtgagctg
gttggggagaggggaaaagtgatggacttctacaaaaccctaaggggaggagctactgtg
aaggtttctgcatctccaccctcactggctgctgctcctctgtcagactccaagcagcta
cgacttttggttgattttccaaaaggctcaggaagcaatgcgcagcagccagatctgtcc
caggcagtttcactctcaatgggactgtatatgggagagacagaaacaaaagtgatggga
aatgacctgggattcccacaaccgggccaaatcagcctttcctctggggagacagacttt
cggcttctggaagaaagcatcgcaaacctcagtaagtcgaccagtgttccagagaatccc
aagagttcagcgtctgctactgtttcggttgcccccgaagaggagttttcaaaaacacac
acggatgcgtcttcagaacagcagaatttgaagagccagaccggcaccaacggtggcaat
gtgaagttgtataccgcagaccaaagagccttcgacattttgcaggatttggagtttcct
tctgggtccccaggtaaagagatgaatgagagcccttggagaccagacctcttgatagat
gaaaactgtttgctttctcctttgggaggagaggaggatccattccttttggaaggaaac
tccaatgaggactgtaagcctctcgttttaccagatactaaacctaaaattaaggataat
ggagatctgatcttaccaagccccagcagtgtgacactgccccaagtgaaaacagaaaaa
gaagaagatttcatcgaactctgcactcctggagtaattaagcaggagagactgggccca
gtttactgtcaggaaagtttttctggggcaaatataattggtaataaaatgtctgccatt
tctgttcacggtgtgagtacctctgggggacagatgtaccactatgacatgaatacagca
tccctttctcaacagcaggatcagaaacctgtttttaatgtcattccaccaatccctgtt
ggttcagaaaattggaataggtgcccaggatctggagatgacaacttgacttccttggga
actttgaacttccccgggcgatcggttttttctaacggctattcaagccctggcatgaga
ccggatgtcagctctcctcctgcatccagctcagcagcatcgggaccacctcccaaactc
tgccttgtgtgctctgacgaagcgtcaggatgtcactatggggtcttgacctgtgggagc
tgcaaagtcttcttcaaaagagcagtggaaggtagacagcacaattacctttgtgctgga
agaaatgattgtatcattgataaaattcgaagaaaaaactgccctgcgtgccgctatcga
aaatgtcttcaagctggaatgaacctggaagctcgaaaaacaaagaaaaagataaaagga
attcagcaggccactaccggggtctcacaggaaacttctgaaaattctgctaacaagaca
atagttcctgcaacattaccacaactcacccctaccctggtgtcactgctggaggtcatt
gagccggaggtgctgtatgcaggatatgattgttcttccccagactctgcttggcggatc
atgaccacactcaacatgttaggtgggcgacaggtgatcgcagcagtgaaatgggcaaag
gcaataccaggattcaggaacttacacctggatgaccaaatgaccctactgcaatattca
tggatgttcctcatggcatttgccctgggctggagatcatacagacaatcaaatgcaaac
atgctgtgttttgctcctgatttggttattaacgagcaaaggatgtctctacccttcatg
tatgaccaatgtaaacacatgctatatgtttcctctgagttacaaaggcttcaggtatct
tatgaagaatatctctgcatgaaaaccttactgcttctctcatcagttcctaaggaaggc
ttgaagagccaagagctgtttgatgagattagaatgacctacatcaaagagctggggaaa
gccattgtcaagagggaagggaactccagtcagaactggcagcggttctaccaactgaca
aaactcttggactccatgcatgaggtagttgaaaatctccttcactattgcttccaaaca
tttttggataaatccatgagtattgaattcccagagatgttagctgaaatcatcaccaat
cagttaccaaaatattcaagtggaaatatcaaaaaacttctgtttcatcaaaagtga

DBGET integrated database retrieval system