KEGG   Myotis brandtii (Brandt's bat): 102258772Help
Entry
102258772         CDS       T02920                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04010  MAPK signaling pathway
myb04020  Calcium signaling pathway
myb04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102258772 (CACNA1E)
   04020 Calcium signaling pathway
    102258772 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102258772 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:myb04040]
    102258772 (CACNA1E)
Ion channels [BR:myb04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102258772 (CACNA1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 102258772
NCBI-ProteinID: XP_005880332
LinkDB All DBs
Position
Un
AA seq 2300 aa AA seqDB search
MQSTPQARRKEWEMARFGEAVVGRPGSGDGDSDQSRNRQGTPVPAAGQAAAYKQSKAQRA
RTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLA
LEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIV
VLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLL
LFFAILMFAIIGLEFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECRDWIGPND
GITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVL
GVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSAL
EVLRRATIKRSRTEVMTRDSSDEHCVDISSVGTPLARASIKSAKVDGASYFRHKERLLRI
SVRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPQWLTHFLYYAEFLFLGLFLLEMSLKM
YGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWA
SLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAI
MTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLA
NAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLR
ERRRRHHMSVWEQRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLY
RRSRPLEGLALGLGLEKCEEERISRGGSLKGDGGDLSSALDHQRSPLPLGKREPPWLARP
CHGNCDPTQQESGGGEAVVTFEDRARHRQSQRRSRHRRVRTEGKEPSSASQSRSASQERG
LDDSAPTEGEKDREPRGGHGGKEPTIQEEERAQDLRRTNSLMVPRGSGLAGALDEADTPL
VPPNTEPEVGKALTEQEPEGSSEQALLGDVQLNVGRVSQSEPDLSCVTANTDKAATESTS
VTVAIPDVDPLVDSTVVHRPGCLEEAIVPVCGGGEARWGRREAVAQGSSTRRIRRACHYI
VNLRYFEMCILLVIAASSIALAAEDPVLTNSERNRVLRYFDYVFTGVFTFEMVIKMIDQG
LILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTI
KRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKEC
IGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDR
GPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDF
AISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTIVLMMKYYSAPCTYELA
LKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSG
FNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVF
GNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQN
ENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWA
EYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTL
MALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIY
AAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPYLQQDPAPGL
SGRSGYPSMSPLSPQEIFQLACMDSADDGQFQEEQALEPEFSELKSVQPSNHGIYLPPDT
QEHAGSGRASSMPRLTVDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFSMERSSENTYKS
RRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRCNSEERGTQA
DWESPERRQSRSPSEGRSQTPNRQGTGSLSESSIPSISDTSTPRRSRRQLPPVPPKPRPL
LSYSSLIRHTGSISPPADGSEGGSPLTSQAPESNDAGLPESSRPPHGHPSPQRYISEPYL
ALHEDAQASDCGEEETLTFEAAVATSLGRANTIGSAPPLRHSWQMPNGHYRRRRRGGPGP
GMMCGAVSDLLSDTEEDDKC
NT seq 6903 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcaccccgcaggcccggcgcaaggagtgggagatggctcgcttcggagaggca
gtggtcggcaggccggggtctggcgatggagactcggaccagagcaggaaccggcaagga
accccggtgcctgccgccgggcaggcggccgcctacaagcagtcgaaagcgcagagggcg
cggactatggctttatacaaccccattcctgtccggcagaactgtttcaccgtcaacaga
tccctgttcatcttcggagaagataacattgtcaggaaatacgccaagaagctcatcgat
tggccgccgtttgagtacatgatcctggccaccatcattgccaactgcatcgtcttggcc
ctggagcagcatcttcctgaggatgacaagaccccgatgtcccgcagactggagaagaca
gaaccctatttcattgggatcttttgctttgaagctgggatcaagatcgtggccctgggg
ttcatcttccacaagggctcatacctccgcaacggctggaacgtcatggacttcatcgtg
gttctcagcggcatcctggccactgcggggacccacttcaacacacatgtggacctgagg
accctccgggccgtgcgtgtcctgaggcccctgaagcttgtgtcagggatacccagcctg
cagatcgtgttgaagtccatcatgaaggccatggtgccccttctgcagatcggcctcctg
ctcttcttcgccatcctgatgttcgctatcatcggcttggagttctacagcgggaagctg
caccgcgcatgcttcatgaacaattcaggtattctagaaggatttgacccccctcacccg
tgtggcgtgcagggctgcccagctggttatgaatgcagggactggatcggccccaacgac
gggatcacccagtttgataacatcctctttgctgtgctgactgtcttccagtgcatcacc
atggaagggtggaccaccgtgctgtacaataccaatgatgccttaggagccacctggaat
tggctgtacttcatccccctcatcatcattggatccttctttgttctcaacctagtcctg
ggagtgctttccggggaatttgccaaagagagagagcgagtggagaaccggagggctttc
atgaagctgcggcgccagcagcagattgagcgggagctgaacgggtaccgcgcctggatc
gacaaagcagaggaagtcatgcttgctgaagaaaataaaaatgctggcacgtcagccttg
gaagtgcttcggagggccaccatcaagcgcagccgcacggaggtcatgactcgagactcc
agcgacgagcactgtgtggatatctcctccgtgggcacacccctcgcccgagccagcatc
aaaagcgcaaaggtggacggggcctcctatttccggcacaaggaaaggcttctgcgcatc
tctgtccgccacatggtgaaatcccaggtgttttactggattgtgctgagcctggtggct
ctcaacaccgcctgcgtggccatcgtccatcacaaccagccccagtggctcacccacttc
ctctactatgcagaatttctgtttctgggactcttcctcttggagatgtccctgaagatg
tacggcatggggcctcgcctttattttcactcttccttcaactgctttgattttggggtc
acggtgggcagtatctttgaagtggtctgggccatcttcagacctggaacatcttttgga
atcagtgtcttgcgagctctccggcttctaagaatatttaaaataaccaagtactgggca
tccctacggaatttggtggtctccttgatgagttccatgaagtctatcatcagtttgctc
ttcctcctcttcctcttcatcgttgtctttgctctcctaggaatgcagctgtttggaggc
aggtttaactttaatgatgggactccttcggcaaactttgacactttccctgcagccatc
atgactgtattccagatcctgacaggtgaggactggaatgaggtgatgtacaatgggatc
cgctcccagggtggggtcagctcaggcatgtggtcagccatctatttcattgtgctcacc
ttgtttggaaactacacgctgctgaatgtgttcttggctatcgctgtggacaatctggcc
aacgcccaggagctgaccaaggatgagcaggaagaagaggaggctttcaaccagaagcac
gcgctgcagaaggccaaggaggtcagcccgatgtccgcacccaacatgccttctatcgaa
agagacagaaggagaagacaccacatgtcgatgtgggagccacgcagcagccacctgcgg
gagcggcggcgccgccaccacatgtcggtgtgggagcagcgcaccagccagctgaggcgg
cacatgcagatgtccagccaggaggccctcaacaaggaggaggccccgcccatgaacccg
ctcaaccccctcaacccactgagccccctcaacccgctcaacgcccaccccagcctctac
cggagatcccggcccctggaggggctggccctgggcctgggcctggagaagtgtgaggag
gagcgcatcagccgcggggggtccctcaagggggacggaggggacctctccagtgccctg
gaccaccagaggagccccttgccgctgggcaaacgggagccgccgtggctggccaggccc
tgccatgggaactgtgacccgacccagcaggagtctgggggaggggaggcggtggtgacc
tttgaggaccgggccaggcacaggcagagccagcggcgcagccggcaccgccgagtcagg
acagaaggcaaggagccctcctctgcctcccagagccggtcggccagccaggagcggggc
ctggatgacagcgcgcccaccgagggggagaaggaccgcgagcccaggggcggccatggg
ggcaaggagcccacgatccaggaagaagagagagcccaggacttgaggaggaccaacagt
ctgatggtgccccgaggctctgggctggcaggagccctcgatgaggctgacacccccctc
gtcccgccaaacacagaaccggaagtggggaaggcgctgacggagcaggagcctgagggc
agcagtgagcaagccctgctgggggacgtgcagctgaacgtgggccgggtcagccagagc
gagcccgacctctcctgcgtcacggccaacacggacaaggctgccaccgagagcaccagc
gtcactgtcgccatccctgacgtggaccccctggtggactcgaccgtggtgcacaggcct
ggctgtctggaagaggccattgtgcctgtgtgcgggggtggggaggcacgatggggacgg
agggaggcggtggctcaaggctcatccacccgcaggatccgcagggcctgtcactacatc
gtgaacttgcgctactttgagatgtgcattctcctggtgatcgcggccagcagcatcgcc
ctggcggccgaggacccggtcctgaccaactcggagcgcaacagagtcctgcggtatttt
gactatgttttcactggcgtgttcacctttgagatggttataaagatgatcgaccagggc
ttgattctgcaggatgggtcctacttccgagacctgtggaacattctggacttcgtggtg
gtggttggtgcgctggtggcctttgctttggcaaacgctttgggaaccaacaaggggcgg
gacatcaagaccatcaagtccctgcgggtgctccgcgtgctgaggcctctgaagaccatc
aagcgcctgcccaagctcaaggctgtctttgactgcgtggtgacctcattgaagaacgtc
ttcaacatcctcattgtctacaagctcttcatgttcatctttgctgttatcgccgttcag
ctcttcaagggaaagttcttttattgcacggacagttccaaggacacagagaaggagtgc
ataggcaactatgtagatcacgagaagaacaagatggaggtgaaaggtcgggaatggaag
cgccatgaattccactacgacaacatcatctgggctctgctgaccctcttcaccgtctcc
acaggggaaggatggcctcaggttttgcagcattctgtcgatgtgacggaggaagaccga
ggcccgagccgcagcaaccgcatggagatgtccatcttttacgtggtctactttgtggtc
ttccctttcttctttgtcaacatcttcgtggctctcatcatcatcaccttccaggagcaa
ggggacaagatgatggaggagtgcagcctggagaagaacgagagggcgtgtatcgacttc
gccatcagcgccaagccgctcacccgctacatgccgcagaacaggcacaccttccagtac
cgcgtctggcacttcgtggtgtctccatcgtttgagtacaccatcatggccatgatcgcc
ttgaacaccatcgtgctgatgatgaagtactactctgcgccctgtacttatgagctggcc
ctgaagtacctgaatatcgccttcaccatggtgttttccttggaatgtgtcctgaagatc
atcgcgtttggcttcttgaactatttccgagacacctggaatatcttcgacttcatcacc
gtgatcggcagcatcacagaaatcattctgacggacagcaagctggtgaacaccagtggc
ttcaatatgagcttcctgaagctcttccgcgctgcccgcctcatcaagcttctgcgacag
ggctacaccatccggattttgctctggaccttcgtgcagtccttcaaggccctgccctac
gtctgccttttgattgccatgctgttcttcatctatgccatcattgggatgcaggtattt
ggaaacataaagttggatgaggagagtcacatcaaccggcacaacaacttccggagtttc
tttgggtccctcatgctactcttcaggagtgccacaggcgaggcctggcaggagataatg
ctgtcgtgcctcggggagaaaggctgtgagcccgacaccacggcgccctccgggcagaac
gagaacgaacgctgtggcaccgatctggcctacgtttactttgtctccttcatcttcttc
tgctccttcttgatgctcaacctgttcgtggccgtcatcatggacaacttcgagtacctg
actcgggactcgtccatcctggggcctcaccacttggatgagtttgtccgcgtctgggca
gaatacgacagagctgcatgtggccgcatccattacactgagatgtatgaaatgctgact
ctcatgtcaccaccgctaggcctcggcaagagatgtccctccaaagtggcctataagagg
ttggtcctgatgaatatgcccgtggctgaggacatgacagtgcacttcacctccaccctg
atggctctgatccggactgctctggacatcaagatcgccaaaggtggtgctgacaggcag
cagctagactcggagctacagaaagagaccctggccatctggcctcacctgtcccagaag
atgctagatctgcttgtgcccatgcccaaagcctctgacctgactgtgggcaaaatctat
gcagcaatgatgatcatggactactataagcagagtaaggtgaagaagcagaggcagcag
ctggaggaacagaaaaatgcacccatgttccagcgcatggagccctcatctctgccgcag
gagatcatcgccaatgccaaagctctgccttacctccagcaggaccccgctccaggcctg
agtggccggagtgggtacccttcgatgagtccgctctccccccaggaaatattccagctg
gcgtgtatggactcagccgatgacggacagttccaggaggagcaggctctggagccagag
tttagtgaattaaaaagcgtgcagccctctaaccatggcatctaccttcctccggacacc
caggagcatgcgggatcggggagggcatcctctatgccacggctgactgtggatccccag
gtagtaacagaccccagctccatgagacgttcgttttccactattcgggacaagcgttca
aattcctcgtggttggaggaattctccatggagcgaagcagtgaaaacacctacaagtcc
cggcgccggagttaccactcctccctgcggctgtcagcccaccgcctgaactcggactcc
ggccacaagtccgacacccaccgctcagggggcagagagcggggacgatcgaaagagcga
aagcatcttctgtcccccgatgtctcccgctgcaactcagaggagcgagggacccaggcc
gactgggagtccccagagcgtcgccagtccaggtcgcccagtgagggcaggtcacagacg
cccaacagacagggcacgggctccttgagtgaaagctccatcccctccatctctgacacc
agcaccccaagacgaagtcgtcggcagctcccacccgtccccccgaagcctcggcccctc
ctgtcctacagctcgctgattcgacacacgggaagcatctctcccccggcggatgggagc
gagggcggctccccgctgacctcccaggctccggagagcaacgacgctggcctgcccgag
tcttccaggcccccgcacggccacccctccccgcagcgctacatctccgagccctacctg
gccctgcacgaagatgcccaagcctcggactgcggcgaggaggagacgctcaccttcgaa
gcggccgtggccaccagcctgggccgtgccaacaccatcggctcagccccgcccctgcga
cacagctggcagatgcccaacgggcactatcggcggcggaggcgtgggggcccggggccg
ggcatgatgtgtggagcagtcagcgacctcctgagtgacacggaagaagacgacaaatgc
tag

DBGET integrated database retrieval system