KEGG   Myotis brandtii (Brandt's bat): 102259510Help
Entry
102259510         CDS       T02920                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00010  Glycolysis / Gluconeogenesis
myb00030  Pentose phosphate pathway
myb00051  Fructose and mannose metabolism
myb00052  Galactose metabolism
myb01100  Metabolic pathways
myb01200  Carbon metabolism
myb01230  Biosynthesis of amino acids
myb03018  RNA degradation
myb04152  AMPK signaling pathway
myb05230  Central carbon metabolism in cancer
Module
myb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102259510 (PFKP)
   00030 Pentose phosphate pathway
    102259510 (PFKP)
   00051 Fructose and mannose metabolism
    102259510 (PFKP)
   00052 Galactose metabolism
    102259510 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102259510 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102259510 (PFKP)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    102259510 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:myb01009]
    102259510 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:myb03019]
    102259510 (PFKP)
Enzymes [BR:myb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102259510 (PFKP)
Protein phosphatases and associated proteins [BR:myb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102259510 (PFKP)
Messenger RNA biogenesis [BR:myb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102259510 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 102259510
NCBI-ProteinID: XP_005869590
UniProt: S7PN37
LinkDB All DBs
Position
Un
AA seq 790 aa AA seqDB search
MDHNGDPSVPRAAFRKFLEQLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYTGAKVYF
IYEGYQGMVDGGNNIVEANWESVSSILQVGGTIIGSARCKAFRTREGRLKAAHNLVQLGI
TNLCVIGGDGSLTGANIFRGEWSTLLEELARDGKISKEDVQKHGHLNIVGMVGSIDNDFC
GTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFL
PESPPEEGWQETMCIKLSENRARKKRLNIIIVSEGAIDTQNKPITSEQIKELVVKQLGYD
TRVTILGHVQRGGTPSAFDRILASRMGVEAVVALLQATPETPACVVSLNGNQAVRLPLME
CVQMTQGVQKAMDERRFSNAVQLRGRSFEGNLNIYKQLAIKKPDSQITKSGFNVAVINVG
APAAGMNAAVRSAVRVGISEGHKMFAVYDGFEGFARGQIKEIGWSDVGGWTGQGGSILGT
KRILPGKYLEDIAAQMRTHSINALLIIGGFEGYLGLLELSAAREKHEEFCVPMVMVPATV
SNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAAG
ADAAYIFEEPFDIRDLQSNVEHLTEKMKTCIQRGLVVRNENCNENYTTDFIYQLYSEEGK
GVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMQWITGKLKEAQGKGRKFVNDDSVCV
LGICQRNLLFQPVAELKEKTDFEHRIPKEQWWLKLRPLMKILAKYKASYEVSDMSQLEHV
HTGPEEPAAI
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggaccacaacggtgacccctcggtccccagagctgccttccgaaagttcctggagcaa
ctctccggggccggcaaagccatcggcgtgctgaccagcggcggggatgcccaaggtatg
aatgccgctgtccgtgctgtcgtgcgcatggggatctacacgggggccaaagtgtacttc
atctatgagggctaccaaggcatggtggatggcggtaacaacatcgtggaagcgaactgg
gagagcgtctccagcatcctgcaagtgggcgggaccattattggcagcgcccggtgcaaa
gccttccgtacccgggaaggccgcctgaaagctgcccacaacctggtgcagctgggcatc
accaacctgtgtgtaatcggcggggacggcagcctcaccggggccaacatcttccgcggg
gagtggagcacgctgctggaggagctggcccgagacggcaagatcagcaaggaggatgtg
cagaagcacgggcacctcaacatcgtgggcatggtgggctccatcgacaatgacttctgc
gggacagacatgaccatcggcactgactcggctttgcaccgcatcatcgaagtcgttgat
gccatcatgacgacagcccagagccaccagaggaccttcgttctcgaggttatggggaga
cactgcgggtacctcgccttggtgagcgccttggcctgtggggcggactgggtgttcctc
ccggaatccccgccagaagagggttggcaggagacgatgtgcatcaagctgtcagagaac
cgggcccggaagaaaaggctgaatatcatcattgtgtccgaaggagcaatcgacacccaa
aataaaccgattacctcggagcaaatcaaggagctggtggtgaagcagctgggatacgac
acccgcgtgaccatcctcggacacgtgcagagaggcgggacgccctcggcctttgacagg
attttggccagccgcatgggggtggaggccgtggtcgccctcctgcaggccacgccagag
accccggcctgcgtggtgtcgctgaacgggaaccaggctgtgcgcctgcccctgatggag
tgcgtgcagatgacccagggcgtccagaaggcaatggatgagaggagattcagcaatgcc
gtgcagctccgaggaaggagctttgagggcaacctcaacatctacaagcagctcgccatc
aagaagccagactcccagatcaccaagagtggcttcaacgtggccgtcatcaacgtgggc
gcaccggctgccgggatgaacgcggctgtgcgctcagctgtgcgggttggcatctcagaa
ggacacaagatgtttgccgtctacgatggcttcgagggctttgccagaggccagatcaaa
gaaatcggctggtcggatgttggaggctggaccggacaaggcggctccattcttgggaca
aaacggatcctccccgggaagtacttggaagacattgctgcacagatgcgcacccacagc
atcaacgcgctgctcatcatcggtgggtttgagggctacctggggctgctggaactgtca
gccgcccgggaaaagcatgaggaattctgtgtccccatggtcatggttcccgccaccgtg
tccaacaacgtgccggggtctgatttcagcatcggtgccgacaccgctctgaacaccatc
actgacacgtgcgaccgcatcaagcagtccgccagcgggactaagcgccgcgtgttcatc
atcgagaccatgggcggctactgcggctacctggctaacatgggggccctggcggccggt
gcggacgccgcctacatcttcgaggagccctttgacatccgagacctgcagtccaatgtg
gagcacctgacagagaagatgaagacctgcattcagaggggccttgtggtcagaaacgag
aactgcaacgagaactacaccaccgacttcatctaccagctctactcagaggagggcaaa
ggggtgttcgactgtaggaagaacgtgctgggccacatgcagcagggaggagcgccttcc
ccatttgacagaaactttggaaccaaaatctccgcccgggccatgcagtggatcacgggg
aagctgaaggaggcgcaaggaaaaggaagaaagtttgtaaacgatgattccgtctgtgtg
ctgggaatatgccaaagaaaccttcttttccagcctgtggcagagctgaaggagaagaca
gactttgagcacagaattcccaaagagcagtggtggctgaagctgcggcccctcatgaag
atcctggccaagtacaaggccagctatgaggtctctgacatgagccagttggagcacgtt
cacaccggccccgaggagcctgcagccatctag

DBGET integrated database retrieval system