KEGG   Myotis brandtii (Brandt's bat): 102260404Help
Entry
102260404         CDS       T02920                                 

Gene name
SETD2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102260404 (SETD2)
Enzymes [BR:myb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102260404 (SETD2)
Chromosome and associated proteins [BR:myb03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102260404 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 102260404
NCBI-ProteinID: XP_005867265
LinkDB All DBs
Position
Un
AA seq 2557 aa AA seqDB search
MLSSLKGPYDMLCYVEGVSFQICFPLGEEENEAKIENVQKTGFIKGPVFKGVASSRFLPK
GTKTKVNLEEQGRQKVSFSFSLTKKTLPNRFLTALGNDKQSDTPTSPAVPLQVDLTPKIK
MDVGETLSTAEDSSPPKSRVELGKIHFKKHLLHVTSRPLLAATTPVTSPPPTVPLPAVIA
ESTTVDSPPSSPPPPPPPPPQATVPSPPAPITEPVALPHAPIMVLMTAPVDLAVRALKEP
PVTIEPESSEVDTKQDTVSNSSEEHIAPTLNEQAHLPSQKEDSHIGKEEESPDSSKRSLS
SRKTGSKKKPSQSEGTFLGSESDEDSVRTSSSQRSHDLKFPASIEKERDSKKSLAPLKSE
DLGKSSRSKTERDDKYFSYSKLERDTRYMSSRCRSERERRRSRSRSRSDRGSRTSLSYSR
SERSHYYDSDRRYRSPYRERARYSRPHTDNRARESSDSEDEYKKTYSRRTSSHSSYRDPR
TSSSYSKSDRDCKTESHSEMEKRGKYSSKPERESRRTSENEAMKRCCSPLNELGFRRGSS
YSKHENSASRYKSAPSKSISKSDKSKNSFCCAELTEEIKHAHSFSLQTHCSKGSEVRVIS
KLPEREKTGSPPLSNRLNDSPAFKKLEESPIFKSEFIGHDSHDSIKELDSLPKVKNDQLR
SYCPMELNINGSPDAESDLVTFCTSKTDTVLMSSDDSVTGSEVSSLVKACVLSSNGFQNI
DSCKEKDLDDTCMQCSKAESPFRETEPPVSPHQDKLMSSPVMTVDCCKTVVKDPVDMRVS
SCKTKDSDVYCASNDNNPSWCRSAAEDAEPPVREISSTSFMSVHLKSKPVTCDNRSLTDQ
HSKFACKEYKSVGSASSASVNHFDDLYQPIESSGVASSLQSLPPGITVDGLALLQCGENT
SPVLGAVLKSKSTEFAKHGEKEMLDVGSGLPALGRGVASWENRHNNGLSGKCLHEAQEEG
NSMLPDKRGRPEISLDEEGRRGHEHTSDDSEVVFSSCELNLTTEDSEYMTYTLKCDSSGH
ASEIVSTVHEEYSGSSESSSDESDSEETDSDDSSVPRNRLQSVVVVPKNSTLPMEETSPC
SSRSSHSYRHYSDHWEDERLEPRRHSYEEKFESIASKACPQTEKFFLHKGTEKSSEMCFT
QMSRKQIDNHLPEIAHPQSDGVDSTSHSDVKSDPGGYPGFEETPRAKIAARQEELPLYSD
DFEDVQNKCWQQTPFPDRPDSRLGRTELNFSSSYEISRVDGFHSSEELRNMGWDFSPQEK
PTTTYQQPDSSYGGRAGHKYQQGTEPYAGTRSSWQGNGYWDPRSAGRPPGTGVVYDRVQG
QVPDSLTDDREEEENWDPRVGSQFSSQSGKFFVSLQQDKGSVQAPEISSNSIKDSLVIND
KKALSKNLEKNDMKDRGPPKKRRQELESDSESDGELQDRKKVRVEAQLCETAAPPGSALA
GPSCVMEDFRDPQRWKECAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMQCECAPLS
KEERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLR
AAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSR
FMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANC
RGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALMENGEGLSDKNQVLSLSRLMVRI
ETLEQKLTCLKLIQNTHSQSRLKSFLERHGLSLLWIWMAELGDGRESNRKLQEEIIKTLE
HLPIPTKNMLEESKVLPIIQRWSQTKTAVPQLSEGDGYSSENTSRAHTPLNTPDPSTKLS
TEADTDTPKKLMFRRLKIISENSMDSAISDATSELEGKDGKEDLDQLETIPVEEEEELQS
QQLLTQQLPESKVDSEIAGEASKLPTPEPEADVEIEPKENSSAKLEEPVAEETPSQDEEE
GVSDVESERSQEQPDKTVDISDLATKLLDSWKDLKEVYRIPKKSQTEKESTVTERGRDAA
VFRDQTAAPKTPNRSRERDTDKQTQSKEKRKRRGSLSPPSSAYERGTKRPEDRYDTPTSK
KKVRKDRNKLSTEERRKLFEQEVAQREAQKQQQQMQNLGMASPLPYDSLGYSAPHHPFAG
YPPGYPMQAYVDPSNPNAGKVLLPTPSLDPVCSPAPYDHSQPLVGHSAEPLAAPPPVPVV
PHVTAPVEVSSSQYVAQSEGVVHQDSSVTVLPVPAAGPVQGQNYGVWDSSQQPVSVQQPY
STPAQSQPSIYYQGQTCPTVYGVTSPYSQTTPPIVQSYAQPSLQYLPGQQLFSAPGVVVQ
PAAAVTTVVAPGQPPPLQPPEMVVTNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKIYY
YHVITRQTQWDPPTWDSPGDEASLEHEAEMDLGTPTYDENPMKASKKPKTAEADTSSELA
KKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNP
EDLECNENVKHKTREYIRKYMQKFGALYRPKEDTELE
NT seq 7674 nt NT seq  +upstreamnt  +downstreamnt
atgttaagcagtttaaaagggccttatgacatgttgtgctatgtggaaggtgtctccttt
caaatctgtttccccctgggagaagaagaaaatgaggcaaagattgaaaatgtgcagaaa
acaggtttcatcaaaggaccggtgttcaaaggtgttgcttctagtcggtttttgcccaaa
ggcaccaagacgaaagttaatttggaggaacagggacgacagaaggtgtcattcagcttc
agccttacaaagaaaactttgccgaacaggtttctgactgcacttggcaatgacaagcaa
agtgatactccaacctccccagctgtacctcttcaagtagacttgacccctaaaattaaa
atggatgttggcgagaccttatctactgcagaagactcttccccaccaaaatcaagggta
gaattgggaaaaattcattttaagaaacatctgcttcatgtaacatccaggccactgcta
gctgcgaccacaccagtgacatcacctccgcccacagtaccgttaccagcagtcatagca
gaatcaacaactgtagactcaccaccttcatctccacctcctccacctcctccacctccc
caagccacagtaccctcaccaccagcaccaataacagagccagtggccttgccacatgca
ccaataatggttctgatgacagcaccggtagatttagcagttagagccttgaaggaacca
ccagttacaattgaaccggaatcttcggaagtggacactaagcaggacactgtatctaat
agttcagaagaacacatagctccgactttgaatgagcaagcacatcttccctcacaaaaa
gaagattcccatattgggaaggaggaggaaagtccagatagttctaagaggagtctgagc
tcgagaaagacaggttctaagaagaaaccctcacaatctgaaggcacctttcttggttca
gaatctgatgaagattctgtccggacttcctcaagtcagagatcacatgatttaaaattt
ccagcaagcattgaaaaggaaagagattcaaaaaagagcttagcacctttaaaaagtgag
gatttagggaaatcttcacgatctaaaacagaaagagatgataaatattttagttactca
aaacttgaaagagatactcggtatatgtcctctcgatgtagatcagagcgagagcgaagg
cgaagcagatctcgttctagatctgacagaggctctagaactagcttatcttattcccgg
tcagaacgatcccattattatgactctgatcgtcgctaccgttccccttatcgagagagg
gcacgttattctcggccgcatacagataacagggcacgagagagttctgattccgaagat
gagtataaaaagacatactcaaggcgcacctcatctcattcctcttacagagacccaagg
acatcatcatcctattctaaatccgatcgggactgcaaaactgaatctcactcagagatg
gagaaaagagggaagtattcttcaaaaccagaaagagaatccagaaggacttcagaaaat
gaagcaatgaaaaggtgttgttctccccttaatgaactgggattccgacgggggtcatca
tattccaagcacgaaaacagtgcttcccgttataaatctgctccttcaaaatctatatcc
aaatctgataaatcaaaaaattctttctgttgtgcagaattaactgaggaaatcaaacac
gctcattcgtttagtttacagactcattgttcaaagggtagtgaagtcagagtgattagt
aaacttcctgaaagagaaaagacgggatctcctcctctatcaaatcgattaaatgattca
ccagcttttaaaaagctagaagaatcgcctatttttaaatctgaatttataggacatgat
agccatgatagtattaaggaattagattctttacctaaagtgaagaatgatcagttaaga
agttactgtcccatggaattaaatataaatggatctcccgatgcagaatctgatttggta
acattttgcacttctaaaactgacacggtcttgatgtcttctgatgacagtgtgactgga
tcggaggtatcctctttggtcaaagcatgtgtgctttcatcaaatggatttcagaacatt
gacagttgtaaagaaaaagacttggacgatacttgcatgcagtgtagtaaggcagaaagc
ccatttagagaaacagaacctccggtgtcgccacaccaagataaactcatgtcttcgcct
gttatgactgtagattgctgcaaaacagtagttaaagacccagttgatatgagagtttct
agctgtaaaaccaaagattcagatgtgtattgtgcttcaaatgacaacaacccttcttgg
tgtcgttctgcagctgaagatgctgagcctccagttagggagatttcttcaactagcttt
atgagcgtgcacttgaaatcaaaaccagttacatgtgataatagaagtctgacagatcag
cactcaaaatttgcatgtaaggaatataagagtgttggtagcgctagttcagcttctgtt
aatcattttgatgatttatatcaacctatagagagttcaggcgttgcttcatctctccag
agtcttccaccaggaataacagtggacggtttagctctcttgcagtgtggagagaacaca
tctccagttctgggtgctgttctgaagagtaaaagcaccgagtttgcaaagcatggagaa
aaagaaatgctagacgtaggcagtggccttcctgctttaggtaggggggttgcttcctgg
gaaaacaggcataataacgggttatctgggaaatgtctgcatgaggctcaagaagaaggg
aatagcatgttgcctgacaaaagaggaagaccagaaatctctttagatgaagaaggaaga
agaggacatgaacacacttctgatgattcagaagttgtattttcttcttgtgagttgaat
ttaaccacggaagacagcgagtatatgacatacaccttaaagtgtgacagtagtggtcat
gcctcagagatcgtgtctactgttcacgaagagtattctggttcctctgaaagttcaagt
gatgaaagcgattcggaagagacagattctgacgacagcagtgttcccaggaaccgtctt
cagtcggtggtggttgtgccaaagaattcgactttgcccatggaagaaacaagtccgtgt
tcttctcggagcagtcacagttacagacactattctgaccactgggaagatgagagattg
gagccaaggaggcattcatatgaggaaaaatttgagagcatagcaagtaaagcctgtcct
caaacggagaagttcttccttcataaaggaacagagaagagttcagaaatgtgtttcaca
cagatgagcagaaaacagatagacaaccacctgcctgaaattgctcaccctcagagtgac
ggagttgatagtacaagtcattctgatgtaaagtcggaccctggaggttatccaggtttt
gaagaaacaccgagagccaaaatagctgccaggcaagaggagctgccactttattctgat
gattttgaagatgttcaaaataagtgttggcaacagacccctttccctgataggccagat
agtagactgggaagaacagaattgaacttctcttcctcttacgagatctcccgagtggat
ggcttccattcatcggaagagctcaggaacatgggctgggacttctctccacaagaaaag
ccgacgaccacgtaccagcagccggacagcagctatggaggccgtgctggacacaagtat
cagcagggcacagagccgtatgctgggacacggagttcctggcaaggcaatggctactgg
gatcccaggtcagcaggtagacctcctggaactggggttgtgtatgatcgagttcaaggt
caggtaccagattccttaacagatgatcgtgaagaggaagagaattgggaccctcgggta
ggatcgcagttttcaagccagtccggtaaattttttgtatcccttcagcaggacaagggg
tcagtgcaagcacctgaaataagcagcaattccattaaggactcattagtcataaatgac
aagaaagcgctttcaaaaaacttagaaaaaaatgatatgaaagatagagggcctcctaaa
aaaaggaggcaggaattggagagtgattctgaaagtgatggtgagcttcaggacagaaag
aaggtgcgagtggaggcacagctgtgcgagacggcagcgcccccaggctcggcgctggcc
ggaccttcctgtgtcatggaggacttcagagacccccagcgatggaaggaatgcgccaag
caggggaagatgccttgttattttgatctgattgaagaaaatgtttatttaacagaaaga
aagaagaataagtcccatcgggacattaagcggatgcagtgcgagtgcgcacctctttct
aaagaggagagagctcaaggtgaaatagcctgtggggaagactgcctcaaccgcctcctc
atgatcgaatgttcttctcggtgtccaaatggggattactgttccaatagacgatttcag
agaaaacagcatgcagatgtggaagtcatactcacagagaagaaaggctggggcttgaga
gctgccaaagaccttccttcgaacacctttgtcctggagtactgtggagaggtccttgat
cataaagagtttaaagcccgggtgaaggagtacgcacggaacaaaaacatccactactac
ttcatggccctgaagaatgatgagataatagatgccactcagaaaggaaattgctctcgt
tttatgaatcatagctgtgagccaaactgtgagactcaaaaatggactgtgaatggacag
ctcagggttgggttttttaccaccaaactggttccttcaggctcagagttaacatttgac
taccagttccagagatatggaaaagaagcgcagaaatgtttctgtgggtcagctaattgc
cggggttacctgggaggagagaacagagtcagcattcgagcagcaggagggaaaatgaag
aaggaacgatcccgtaagaaagattcagtggatggagagctagaagcgctgatggagaac
ggggagggtctctctgataaaaaccaggtgctcagcttatcccggctaatggttagaatt
gaaactttggaacagaaacttacctgtctgaagctcatccagaacactcactcccagtct
cgcctgaagtcctttctggagcgccatgggctgtctttgctgtggatctggatggcggag
ctgggggacggccgggaaagcaaccggaagcttcaggaggagattataaagactttggaa
cacttacctattcctactaaaaatatgttggaagaaagcaaagtacttccaattattcaa
cgttggtctcagaccaagactgctgttcctcagttgagtgaaggagatgggtattctagt
gagaacacgtcacgggctcacacaccgctcaacacacctgatccttccaccaagctgagc
actgaagctgacacagacacccccaagaagctcatgtttcgccgacttaaaattataagc
gagaatagcatggacagtgccatctctgatgccactagcgagctagaaggcaaagatggc
aaagaggaccttgaccagttggaaaccatccctgtagaagaagaggaggagttacagtca
cagcagctgctcacacaacagctgcctgagtctaaagttgatagtgaaattgctggggag
gccagtaagctacccacccctgagccggaggctgatgtcgaaatagagccaaaagagaac
agcagtgcgaagctggaagagcctgttgctgaggaaacgccgtcccaagatgaggaggag
ggcgtgtctgatgtggagagtgagaggagccaggagcagccggacaaaaccgtcgatatc
agtgatctggccaccaagctcctggatagttggaaagatctaaaggaggtctatcgaatt
ccaaagaaaagtcagacggaaaaggagagcacagtaactgagcgaggaagggatgctgct
gtcttcagagatcaaaccgctgccccaaagactcctaaccggtcaagagagagagacaca
gacaagcagactcagagtaaagagaaaaggaaacgaaggggctccctctcaccgccctcc
tctgcctacgagcgagggacaaaaaggccagaggacagatatgatacaccaacttctaaa
aagaaagtacgaaaagaccgcaataagctttctacggaggagcgtcggaagttgtttgag
caagaggtggctcagcgggaggctcagaaacagcagcagcagatgcagaacctgggaatg
gcatctccactgccctacgactctcttggctacagtgccccccatcacccctttgccggc
tacccaccagggtaccccatgcaggcctatgtggaccccagcaaccccaatgctgggaag
gtgctcctccccacccccagcctggaccctgtgtgctctcctgctccttacgaccattct
cagcccttggtgggacattctgcagagcccctggctgcccctccacctgtgccagtggtg
ccacatgtgacagcccctgtggaagtttccagttcacagtatgtggcccaaagtgaaggt
gtggtacaccaggactccagcgtcaccgtcttgcctgtgccggccgcgggcccagtccag
ggacagaactacggtgtttgggattccagccaacagcctgtcagtgtgcagcagccgtac
tcgacgcccgcacagtcgcagccaagcatctattaccaaggacagacgtgtccaaccgtc
tatggtgtgacatcaccctattcacagacaacgccaccgattgtacagagttatgcccag
ccgagcctgcagtacctcccgggccagcagctcttctcagcgccaggagtggtggtccag
ccagccgccgccgtgaccacggtcgtggcaccagggcagcctccgcccttacagccacct
gaaatggttgtgacaaataatctcctggacctgccgcctccctcccctccaaaaccaaaa
accatcgtcttgcctcccaactggaagacggcccgcgaccctgaggggaagatttattac
taccacgtcatcacaaggcagactcagtgggaccctcccacgtgggacagcccaggagac
gaggccagccttgagcatgaagctgagatggacctgggaaccccaacatacgatgaaaac
cccatgaaggcctcaaaaaagcccaagacagcagaggcagacacctccagcgagctggcc
aagaaaagcaaggaagtgttcagaaaagagatgtcccagttcatcgtccagtgcctgaac
ccttaccggaaaccggactgcaaagtgggaagaattaccaccacggaggacttcaagcac
ctcgctcggaagctgactcacggcgtcatgaacaaggagctgaagtactgcaagaacccg
gaggacctggagtgcaacgagaacgtgaagcacaagaccagggagtacatcaggaagtac
atgcagaagttcggggccctttacagacccaaagaagacacggagctagagtga

DBGET integrated database retrieval system