KEGG   Myotis brandtii (Brandt's bat): 102260644Help
Entry
102260644         CDS       T02920                                 

Gene name
BRAF
Definition
(RefSeq) B-Raf proto-oncogene, serine/threonine kinase
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb01521  EGFR tyrosine kinase inhibitor resistance
myb01522  Endocrine resistance
myb04010  MAPK signaling pathway
myb04012  ErbB signaling pathway
myb04015  Rap1 signaling pathway
myb04024  cAMP signaling pathway
myb04062  Chemokine signaling pathway
myb04068  FoxO signaling pathway
myb04150  mTOR signaling pathway
myb04270  Vascular smooth muscle contraction
myb04510  Focal adhesion
myb04650  Natural killer cell mediated cytotoxicity
myb04720  Long-term potentiation
myb04722  Neurotrophin signaling pathway
myb04726  Serotonergic synapse
myb04730  Long-term depression
myb04810  Regulation of actin cytoskeleton
myb04910  Insulin signaling pathway
myb04914  Progesterone-mediated oocyte maturation
myb04928  Parathyroid hormone synthesis, secretion and action
myb04934  Cushing syndrome
myb05034  Alcoholism
myb05160  Hepatitis C
myb05161  Hepatitis B
myb05200  Pathways in cancer
myb05205  Proteoglycans in cancer
myb05210  Colorectal cancer
myb05211  Renal cell carcinoma
myb05212  Pancreatic cancer
myb05213  Endometrial cancer
myb05214  Glioma
myb05215  Prostate cancer
myb05216  Thyroid cancer
myb05218  Melanoma
myb05219  Bladder cancer
myb05220  Chronic myeloid leukemia
myb05221  Acute myeloid leukemia
myb05223  Non-small cell lung cancer
myb05224  Breast cancer
myb05225  Hepatocellular carcinoma
myb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102260644 (BRAF)
   04010 MAPK signaling pathway
    102260644 (BRAF)
   04012 ErbB signaling pathway
    102260644 (BRAF)
   04068 FoxO signaling pathway
    102260644 (BRAF)
   04024 cAMP signaling pathway
    102260644 (BRAF)
   04150 mTOR signaling pathway
    102260644 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102260644 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102260644 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102260644 (BRAF)
   04062 Chemokine signaling pathway
    102260644 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102260644 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    102260644 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    102260644 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102260644 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    102260644 (BRAF)
   04720 Long-term potentiation
    102260644 (BRAF)
   04730 Long-term depression
    102260644 (BRAF)
   04722 Neurotrophin signaling pathway
    102260644 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102260644 (BRAF)
   05205 Proteoglycans in cancer
    102260644 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102260644 (BRAF)
   05212 Pancreatic cancer
    102260644 (BRAF)
   05225 Hepatocellular carcinoma
    102260644 (BRAF)
   05226 Gastric cancer
    102260644 (BRAF)
   05214 Glioma
    102260644 (BRAF)
   05216 Thyroid cancer
    102260644 (BRAF)
   05221 Acute myeloid leukemia
    102260644 (BRAF)
   05220 Chronic myeloid leukemia
    102260644 (BRAF)
   05218 Melanoma
    102260644 (BRAF)
   05211 Renal cell carcinoma
    102260644 (BRAF)
   05219 Bladder cancer
    102260644 (BRAF)
   05215 Prostate cancer
    102260644 (BRAF)
   05213 Endometrial cancer
    102260644 (BRAF)
   05224 Breast cancer
    102260644 (BRAF)
   05223 Non-small cell lung cancer
    102260644 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    102260644 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102260644 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102260644 (BRAF)
   05160 Hepatitis C
    102260644 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102260644 (BRAF)
   01522 Endocrine resistance
    102260644 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myb01001]
    102260644 (BRAF)
Enzymes [BR:myb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102260644 (BRAF)
Protein kinases [BR:myb01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   102260644 (BRAF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Motif
Other DBs
NCBI-GeneID: 102260644
NCBI-ProteinID: XP_014402220
LinkDB All DBs
Position
Un
AA seq 767 aa AA seqDB search
MIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVS
SSASTDTVTSSSSSSLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPAR
CGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPL
TTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVS
KFFEHHPIPQEEASFAETTLTSGSSPSTYSSDSFGPQMLTSPSPSKSIPIPQPFRPADED
HRNQFGQRDRSSSAPNVHINTIEPVNIDEKFPEVELQDQRDLIRDQGFRSDGAPLNQLMR
CLRKYQSRTPSPLLHSVPSEIVFDFEPGPVFRGSTTGLSATPPASLPGSLTNVKALQKSP
GPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDV
AVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHH
LHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATV
KSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNIN
NRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARS
LPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgattaagttgacacaggaacatatagaggcgctattggacaaatttggtggggagcat
aatccaccatcaatatatctggaggcctatgaagaatacaccagcaagctagatgccctc
caacaaagagaacaacagttattggaatccctggggaatggaactgatttttctgtttct
agctctgcatcaacggacaccgttacatcttcttcctcttctagcctttcagtgctacct
tcatctctttcagtttttcaaaatcccacagatgtgtcacggagcaaccctaagtcacca
cagaaacctattgttagagtcttcctgcccaacaaacagaggacagtggtacctgcaagg
tgtggagttacagtccgggacagtctaaagaaagccttgatgatgagaggtctaatccca
gagtgctgtgctgtttacagaattcaggatggagagaagaaaccaattggatgggacact
gatatttcctggcttactggagaggaattgcatgtcgaagtattggaaaatgttccactt
acaacacacaactttgtacggaaaacttttttcaccttagcattttgtgacttttgtcga
aagctgcttttccagggtttccgctgtcaaacatgtggttataaatttcaccagcgttgt
agtacagaggttccactgatgtgtgttaattatgaccaacttgatttgctgtttgtctcc
aagttttttgaacaccacccaataccacaggaggaggcctcctttgcagagactaccctt
acatctggatcatccccttccacatactcctctgattcttttgggccccaaatgctcacc
agtccgtctccttcaaaatccattccaattccacagcctttccgaccagcagatgaagat
catcgaaatcagtttggacaacgagatcggtcctcatcggctccaaatgtgcatataaac
acaatagaacctgtcaatattgatgaaaaattcccagaagtggaattacaggatcaaagg
gacttgattagagaccaagggtttcgtagtgatggagcccctttgaaccagctgatgcgc
tgtcttcggaaataccaatcccggactcccagtcccctcctacattctgtccccagtgaa
atagtgtttgattttgagcctggcccagtgttcagagggtcaactacaggtttatctgcc
accccccctgcctcattacctggctcactcactaatgtgaaagcattacagaaatctcca
ggacctcagcgggaaagaaaatcatcttcatcctcagaagacaggaatcgaatgaaaaca
cttggtagacgggattcaagtgacgattgggagattcctgatgggcagatcacagtagga
cagagaattggttccgggtcatttgggacagtctacaaggggaagtggcatggtgatgtg
gcagtgaaaatgttgaatgtgacagcacctacacctcagcagttacaggccttcaagaat
gaagtaggagtactcaggaaaactcgacatgtaaatattctactcttcatgggctattca
acaaagccacaactggctattgttacccagtggtgtgagggctccagcttatatcaccat
ctccacatcattgagaccaaatttgagatgatcaaacttatagatattgcacggcagact
gcacagggcatggattacttacacgccaagtcaatcatccacagagacctcaagagtaat
aatatttttcttcatgaagacctcactgtaaaaataggtgactttgggctagccacagtg
aaatctcgatggagtgggtcccatcagtttgaacagttgtctggatccattctgtggatg
gcaccagaagtaatcagaatgcaagacaaaaacccttatagctttcagtcagatgtatat
gcatttgggattgttctgtatgaattgatgactggacagttaccttattcaaacatcaac
aacagggaccagataatttttatggtgggacgaggatatctatctccagatctcagtaag
gtacgaagtaactgtccaaaagccatgaagagattaatggcagaatgcctaaaaaagaaa
agagatgagagaccactctttccccaaattctcgcctctattgagctgttggcccgctca
ttgccaaaaattcaccgcagtgcatcagaaccctccttgaatcgggctggcttccaaaca
gaggattttagtctatatgcttgtgcttctccaaaaacacccatccaggcagggggatat
ggagaatttgcagccttcaagtag

DBGET integrated database retrieval system