KEGG   Myotis brandtii (Brandt's bat): 102261840
Entry
102261840         CDS       T02920                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04022  cGMP-PKG signaling pathway
myb04141  Protein processing in endoplasmic reticulum
myb04151  PI3K-Akt signaling pathway
myb04211  Longevity regulating pathway
myb04261  Adrenergic signaling in cardiomyocytes
myb04668  TNF signaling pathway
myb04728  Dopaminergic synapse
myb04911  Insulin secretion
myb04915  Estrogen signaling pathway
myb04918  Thyroid hormone synthesis
myb04925  Aldosterone synthesis and secretion
myb04926  Relaxin signaling pathway
myb04927  Cortisol synthesis and secretion
myb04928  Parathyroid hormone synthesis, secretion and action
myb04934  Cushing syndrome
myb04935  Growth hormone synthesis, secretion and action
myb05020  Prion disease
myb05030  Cocaine addiction
myb05031  Amphetamine addiction
myb05034  Alcoholism
myb05161  Hepatitis B
myb05163  Human cytomegalovirus infection
myb05166  Human T-cell leukemia virus 1 infection
myb05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:myb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102261840 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102261840 (ATF6B)
   04022 cGMP-PKG signaling pathway
    102261840 (ATF6B)
   04151 PI3K-Akt signaling pathway
    102261840 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102261840 (ATF6B)
   04915 Estrogen signaling pathway
    102261840 (ATF6B)
   04926 Relaxin signaling pathway
    102261840 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    102261840 (ATF6B)
   04918 Thyroid hormone synthesis
    102261840 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    102261840 (ATF6B)
   04925 Aldosterone synthesis and secretion
    102261840 (ATF6B)
   04927 Cortisol synthesis and secretion
    102261840 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102261840 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    102261840 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    102261840 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102261840 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    102261840 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    102261840 (ATF6B)
   05031 Amphetamine addiction
    102261840 (ATF6B)
   05034 Alcoholism
    102261840 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102261840 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102261840 (ATF6B)
   05161 Hepatitis B
    102261840 (ATF6B)
   05163 Human cytomegalovirus infection
    102261840 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:myb03000]
    102261840 (ATF6B)
Transcription factors [BR:myb03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102261840 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 ZapB DUF4407 GIT_CC bZIP_Maf YabA Docking
Other DBs
NCBI-GeneID: 102261840
NCBI-ProteinID: XP_005859910
LinkDB
Position
Un
AA seq 701 aa
MAELMLLSEIADPTRFFTDNLLGPEDWGAWRAAXXXXXARPPPCLTAPPPHAPPLQFGSG
MLDVGMDVSPPEPPWDPLPLFPDLQVKSEPSSPCSSSSLSSESSGLSTEPSPQAPGVGEV
LVVKIESLAPPLCLLGDDPTSLSETVQINVGPTADDPSGVQTKTEPVSPSSINSEASLLS
TESPNQAFVGKEALEVKTESPAPQGCLLRDVPGPPLGAVQISMGPPPEGSSGKALPARKP
PLQPKPVVITTVPVPPSAVPPSTTVLLQPLAQPPPVSPVVLIQGAIRVQPEGPAPPAPRP
ERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAVLA
DNQQLRRENAALRRRLEALWTENSELKLGSGNRKVVCIVVFLLFIAFNFGPVSISEPPAA
PVSPRMSMSGEEPRPRRHLLEFSAQLPVRGVQSLQDPSQGPQEPQPSLEGRPSFRNLTAL
PGGAAELLLPGLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKAPRRAQERQKS
QRRKLPPVKAVPTQPPGPPERDSVGQLQLYRHPDRSQPEFLDAIDRREDTFYVVSFRRDH
LLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVIHIKTST
VPPSLRKQPSTPGNATGGPLPASAAGQAHQATHRPLYLNHP
NT seq 2106 nt   +upstreamnt  +downstreamnt
atggcggagctaatgctcctcagcgagattgcggacccgacgcggtttttcaccgacaac
ttgctgggcccggaggactggggtgcgtggagggcggcctgnnnnnnnnnnngggctcgg
ccccccccctgtctcacagcccctccccctcatgccccccctcttcagttcggcagcggc
atgctggacgtggggatggatgtcagcccccccgagcctccgtgggaccccctgcctctc
tttccagatcttcaggtgaagtctgagccgtcctctccctgctcctcctcctctctcagc
tccgagtcgtccggcctttccacggagccctccccccaggcccctggtgtaggggaggtg
ctggttgtgaagatagagtccttggcaccaccgctctgcctgctgggagatgatccaaca
tccctgagtgaaacggtccagatcaatgtgggccccaccgctgatgacccctcaggggtc
cagacgaagacagaacccgtctctccttcctccatcaactctgaggcttccttgctctcc
acagagtcccccaaccaggcttttgtaggaaaggaggcactggaagtgaagaccgagtct
ccagcccctcaggggtgtctcctacgggatgtccctggcccgccacttggagctgtccag
atcagcatgggcccaccccccgagggctcctcaggcaaagccctgcctgcccggaagcca
ccactgcagccgaaacctgtggtgataaccactgtcccagtgccgcccagcgcggtgccc
cccagcaccaccgtccttctgcagccccttgcccagccacccccagtgtccccagttgtc
cttatccaaggtgctattcgagtccagcctgaggggccagccccccctgctcctcggcct
gagaggaagagcattgttccagctcctatgcctgggaactcctgcccacctgaagtggac
gcaaagctgctgaagcggcagcagcgaatgatcaagaaccgggagtcggcttgccagtcc
cggaggaagaagaaggagtacctgcaggggctggaggcgcggctgcaggccgtgctggcg
gacaaccagcagctgcgccgggagaacgctgccctccggcggcggctggaggccctgtgg
actgagaacagcgaactcaagttagggtctgggaacaggaaggtggtctgcatcgtggtc
tttcttctcttcattgccttcaactttgggcctgtcagcatcagtgagcctcctgcggct
cccgtctctcctcggatgagcatgagcggagaggagcctcggccccggagacacctgctg
gagttctcagcgcagctgcccgtccgtggagtccagtccctccaggacccctcccagggc
ccccaggagccccagcccagcctcgagggccggccgagtttcaggaacctgacagcgctc
cctgggggcgccgcggagctgctgctgccaggcctggaccagctcttcctctcctcggac
tgccggcacttcaaccgaaccgagtccctcaggcttgctgacgagctgagcggctgggtg
cagcgccaccagagaggccggcggaaggcgccccgcagggcccaggagagacagaagtct
cagcgacggaagttgcctccagttaaggcagtccccactcagccccccgggcccccagaa
agggattccgtgggccagctgcagctatatcgccacccggatcgttcacagccagagttc
ctggatgcaattgaccgacgggaagacacattttatgttgtctccttccggcgggaccac
ctgctgctcccagccatcagccacaataagacctctcggcccaagatgtccctggtgatg
cccgccatggcccccaatgagaccctgtcagggcggggtgcccctggggactatgaggag
atgatgcagatcgagtgtgaggtcatggacaccagggtgattcacatcaagacctccacg
gtgcccccctcgctccgaaaacagccttccaccccgggcaatgccacaggtggccccttg
ccagcttctgcagccggccaggcccaccaggccacccatcggcccctctacctcaatcac
ccctga

DBGET integrated database retrieval system