KEGG   Myotis brandtii (Brandt's bat): 102262078
Entry
102262078         CDS       T02920                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb01521  EGFR tyrosine kinase inhibitor resistance
myb04010  MAPK signaling pathway
myb04012  ErbB signaling pathway
myb04014  Ras signaling pathway
myb04151  PI3K-Akt signaling pathway
myb04915  Estrogen signaling pathway
myb05200  Pathways in cancer
myb05210  Colorectal cancer
myb05211  Renal cell carcinoma
myb05212  Pancreatic cancer
myb05214  Glioma
myb05215  Prostate cancer
myb05223  Non-small cell lung cancer
myb05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102262078 (TGFA)
   04012 ErbB signaling pathway
    102262078 (TGFA)
   04014 Ras signaling pathway
    102262078 (TGFA)
   04151 PI3K-Akt signaling pathway
    102262078 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102262078 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102262078 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102262078 (TGFA)
   05212 Pancreatic cancer
    102262078 (TGFA)
   05225 Hepatocellular carcinoma
    102262078 (TGFA)
   05214 Glioma
    102262078 (TGFA)
   05211 Renal cell carcinoma
    102262078 (TGFA)
   05215 Prostate cancer
    102262078 (TGFA)
   05223 Non-small cell lung cancer
    102262078 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102262078 (TGFA)
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 102262078
NCBI-ProteinID: XP_014396422
LinkDB
Position
Un
AA seq 242 aa
MSLRGHMFLEGLHRARLSKHNQGCRRSGHLGLRRLAVRGLDIHTFAPRETLLAEGELEAM
EIPKRQRMWPLEERAPASMLDLLNLSFGLILEAVTGLVLAVCQALENTTSALSANPPMAA
AVVSYFNDCPDSHSQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQ
AITALVVVSVVALAGLIITCVLIHCCQVRKYCEWCRALICQHEKPSALLKGRPACCHSET
VV
NT seq 729 nt   +upstreamnt  +downstreamnt
atgagcctcagaggccacatgtttctggaaggccttcacagagccaggctttccaagcac
aaccaggggtgccggcggtcgggacacctgggcctacgtagattggcagtcaggggtctg
gacattcacaccttcgcccctcgggagaccttgctcgcagagggggaattggaggccatg
gaaattcccaagaggcaacggatgtggcctctagaagagagggctccagcttcgatgcta
gacctgctgaatctgtcgtttggactcattttggaggctgtaactggtcttgtgttggct
gtgtgtcaggccctggagaacactacatctgccttgagtgcaaatccacccatggccgca
gctgtcgtgtcctactttaatgattgcccggattcccacagtcagttctgcttccatgga
acctgcaggtttttggtgcaggaggacaagccagcatgtgtctgccactctgggtatgtc
ggagcgcgctgtgagcatgcagacctcctggccgtggtggccgccagccagaagaagcag
gccatcaccgccttagtggtggtttccgtcgtggccctggctggcctcatcatcacgtgt
gtgctgatacactgctgccaggtccgaaaatactgtgagtggtgccgggccctcatctgc
cagcacgagaagcccagcgccctcctgaaaggaaggcctgcttgctgccactcagaaaca
gtggtctga

DBGET integrated database retrieval system