KEGG   Myotis brandtii (Brandt's bat): 102262411Help
Entry
102262411         CDS       T02920                                 

Gene name
MGAM2
Definition
(RefSeq) maltase-glucoamylase 2 (putative)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00052  Galactose metabolism
myb00500  Starch and sucrose metabolism
myb01100  Metabolic pathways
myb04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102262411 (MGAM2)
   00500 Starch and sucrose metabolism
    102262411 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102262411 (MGAM2)
Enzymes [BR:myb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102262411 (MGAM2)
    3.2.1.20  alpha-glucosidase
     102262411 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102262411
NCBI-ProteinID: XP_014402193
LinkDB All DBs
Position
Un
AA seq 2555 aa AA seqDB search
MARKLRVLEIFLFICFLIVLAADIFLLFLVLEDTSDAPFSPQCPEIPESHRIDCAPGEMV
SKENCIEKYKCCWKPVSDTNVPRCFFPRNWGYEVNGSLKYENTGLTADLKKVLTPSRFGD
DVSNAHFTAEYQTCRRLRFKITETNNTRYEVSHEHVKLFNMTVGSTNRSYYIEVIEKPFG
IKIMRMSNKKVLLDTSIGPLLFANQYLQLSFLLPSANVYGLGEHVHQQYRHNMGWKTWPI
FTRDATPTKGMINLYGAHTFFLCLEDASGSSFGVFLMNSNAMEVTLQPAPAITYRTIGGI
FDFYVFLGDTPEQVVQEYLELVGRPFLPSYWNLGFQLSRRNYNNIEGLKEVVDRTRKARI
PYDVQYSDIDYMDGKKDFTIDEKAFPGLSDFAKNLHEHGQKYVIIMNPGILHDSEYQPYK
NGRKKRVWILGNKGFVTGQGYPGKIVFPAYDNPTCTQWWTEELQEFHKTLEFDGVWLEME
EVSILQGSDHGCEDNNWNYPPFTPRVLDRSLFAGTLCMDAEVYQELHYNVHSLYGYSMAR
ATDSALNTVFPNKRNFILSRSTFAGSGKFAAHWLGDNAAAWDDLRWSIPSILEFNLFGIP
MVGANICGYKNNTTEELCRRWMQLGAFYPLSRNHNGPGFRDQDPAAFGEDSQLLSSSRHY
LNIRYTLLPYLYTLFYRAHTLGKTVARPLVHEFYQDNATWDVHEQFLWGPGLLITPVLYE
GVDRVKAYIPDAIWYDYETGTAIQWRKQLVEMLLPPDRIGLHLRGGCIFPIQQPNTTTEA
SRKNSLGLIIALDYKREAKGELYWDDGVSADAVTKKNYILYEFSVTSNHLQAKITNNYMD
PDNLTFTDIIILGMDKEPTNFVLNDIAILNVSYNASTKVVKITDLEGLVLGQEFSMRWTL
LVSDQEKFNCYPEDPTASEEKCKQRGCLWENTVVPGVPTCFYDTIPKYAPSNIQYSPTGI
TTDLTHLTAPESARAAAPSPRSTRHTPAAAAATSHPLSAEISSLRISVIYHTESMLQFKI
YDPTNKRYEVPVPLNTPSSPVGSPENRLYDVRIQNHPFGIQIQRKSSSTFKKNSYGVHPY
YMGLEEDGNAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYVFLGPTPELVTQQYTEL
IGRPAMISYWALGFQLSRYGYQSDTEISNLYDEMVEAQIPYDVQHVDIDYMDRKLDFTLS
TSFQNLSLLMERMKKNGTRFVLVLNPGISRNETKYLPFTTGQENNVFIKWPNSSDIVWGE
VRIGRRCLXLISITIDPVXEPVLLFQMYKAHIAYPDFLRNSTAAWWKEEIKKLYTNPKSL
KFDGLWIDKNEPSNFVDGSVSGCRDEILNKPPYMPYLESRDRGLSSKTLCMESEQILPDG
SRVRHYDVHSLYGWSQTRPTYEAVQEVTDQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQ
LRKSIIGMMEFSLFGIPYTGANICGFLGNAEYEMCLRWMQLGAFYPFSRNHNTIGTRRQD
PVAWNSTFQTYSRKVLQTRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFREDRTTWDIDRQ
FMLGPAVLISPVLTSNTFEVHAYFPRARWYDYSMESGNTSTGEWRILEAPLDHINLHIRG
GYILPWQEAAMNTHSSRQLFMGLIVALDDNGNAEGQMFWDDGQSIDTYENGNYFLANFTA
SQNILQIQTMHNKYLNDSNQLKVGYIKIWGIHSTYVTQVNVTYDNKQFTTTNFMSDPYNQ
TLTIQLIDKIFSLEKLTEVTWSHHVPDVTTTPMTSTFSSTSPDPTSTIIATISESIVTSF
ASSTSSASNSTASPIITTSFPTSTIEDTPGTIVPNTPFPTNTTTASTGTAFPITTTNTTT
PFPTTTPFPTNTTTEITGTAFPITTTNTTTPFPTTTPFPTNTTTEITGTAFPITTTNTTT
PFPTTTPFPTNTTTEITGTAFPITTTNTTTPFPTTTPFPTNTTTEITGTAFPITTTNTTT
PFPTTTPFPTNTTTEITGTAFPITTTNTTTPFPTTTPFPTNTTTEITGTAFPITTTNITT
FPTATPFPTTTTTVSTGTAFPIPTTNTTTPYPTNTTTEITGTAFPSTTTNTTTPYPTNTT
TEITGTAFPSTTTNTTTPYPTNTTTEITGTAFPSTTTNTTTPFLTTTTTASTGTAFPITT
TNTTTPFPKTTPTAITGTAFPFTTTNTTTPFPTNTTTASTGTAFPITTTNTTTPFPTNTT
NTTTGTAGLITTPLSPTDTNATSTNNTLPITTIPSLTNTETDTTSMDSVTTNVLNTTTAR
NTKTTTAITTVTLITNGTSEQTTTVIMSTLPPTGTLGITTTDNALTRISTTTYPPDTPTH
ALSTTSRSTQSTTNTNITNMTTGVTDIINTPTRNSSATTDTIITSTQDISTSSHMNITDI
KSTTKVTGNAITAYTTTITTSVFSTKTANSNTTSDTILTNTYIPSTTAIPTTNTMNTTEH
SENIADEDNSRSVFIPNTTVASDSLTPFLDTATHHHVTTNSTTSFLPLIVTNATTAITNV
TIYASNTSIPDRTPMDASTPASSYIANTTNTTVVP
NT seq 7668 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagctccgtgtgttggaaatctttctgttcatctgcttcctaattgtattg
gccgcggatatcttcttgctgtttctggtgcttgaggatacttcagatgctccatttagt
ccacagtgccctgagatccctgaatcacataggatagactgtgcgcctggcgagatggtg
tcaaaggaaaactgcattgagaaatataagtgctgctggaagcctgtgtcagacactaat
gtccccaggtgcttcttccccaggaactggggctatgaagtcaatggaagccttaaatat
gaaaacacagggttaactgctgacttgaaaaaggtgctaaccccatctcggtttggagat
gatgtctctaatgcccacttcacagctgagtatcagacatgcaggcgtcttcgttttaag
atcactgaaaccaataacacacgctatgaagtctcccatgagcatgttaaactgtttaat
atgactgttggttccaccaaccggagctattacatcgaggtcatagagaaaccctttggc
atcaaaataatgaggatgagcaacaaaaaagtcttgttggacacgagcattgggcccctc
ctgttcgccaatcagtacctgcagctgtccttcctgctgcccagcgccaacgtgtatggg
ctcggagaacacgtgcaccagcagtaccgccacaacatgggctggaagacctggcccatc
ttcacccgggatgccacccccaccaagggcatgattaacttgtatggagctcacacattc
ttcttgtgccttgaagacgccagtggctcctcttttggggtctttctgatgaacagtaat
gctatggaggtcacccttcagccggctcctgcaatcacttaccgcaccatcgggggcatt
tttgacttttatgtgttcctgggagacactccagaacaagtggttcaggaatacctggag
cttgttggacggccattcctgccttcctactggaatcttggtttccagcttagtcgcagg
aattataataacatcgagggattgaaagaggttgtagaccgaactcgtaaagctaggatc
ccatatgatgttcagtactcggacatagactacatggatggaaagaaggacttcactatt
gatgaaaaggctttccctggtctctcagattttgccaagaacttacacgaacatggacag
aaatatgtaattattatgaatcctggcatcttacatgattctgaataccagccctataag
aatggaagaaaaaagagagtatggatcttggggaataaaggctttgtcactggacaggga
tatcccggaaagatagtctttcctgcttatgataatccaacttgtactcaatggtggaca
gaagagcttcaagaatttcataaaactttggagtttgatggagtgtggcttgaaatggag
gaagtatctattctccaaggttctgatcatgggtgtgaagataacaactggaactatcct
cctttcactccccgagttctggaccgctcgctttttgcaggaaccctctgcatggacgcc
gaggtttaccaggagcttcactataatgtccacagcttgtatggctactccatggcaaga
gccacagactcggccttgaatactgtcttccccaataagaggaacttcatcttgtctcgt
tctacttttgctgggtctggcaagtttgcagctcattggttaggggacaatgcagctgca
tgggatgatcttcgatggtccatccctagtatccttgagttcaacctatttggcatcccc
atggtcggtgccaatatctgtggttataaaaataataccacagaggagctctgcagaaga
tggatgcagcttggagcattttatccactatccaggaatcacaatgggcctgggttcagg
gaccaggaccctgctgcctttggtgaagactctcagctcttgagttcctccaggcattat
ctgaacatccgctacaccctgctgccttatctctacaccctcttctaccgagctcatacc
ctggggaaaactgtagcgaggcccctggtccatgagttctaccaggacaatgctacatgg
gatgtgcatgagcagttcttatggggacctggactcctcatcacgcctgtgttatatgaa
ggtgtggaccgggtgaaagcatacataccagatgccatctggtacgactatgagacagga
acagccatccaatggaggaaacaattggtggagatgctactgccccctgataggatagga
cttcaccttcgagggggctgcatatttcccatccagcagccaaacacaaccacagaggcc
agtcggaagaactccctgggactcattattgccttggactacaagagagaagcaaaggga
gagctgtactgggatgatggtgtatctgcagatgctgtaacgaaaaagaattatattctg
tatgagttttctgtcacctcgaaccatctacaagcaaagattacaaataattatatggac
cccgacaacctcacatttacagatatcataatcttgggaatggacaaagaacctactaat
tttgtccttaatgatattgccattttaaacgttagctacaatgcatcaacgaaggtggtg
aaaatcactgatctcgagggactggtactgggacaagaattctccatgaggtggactctt
ttggtcagtgaccaagagaagttcaactgctaccctgaggatcccactgcctctgaggag
aagtgcaagcagcgggggtgcctttgggagaacacagttgttcctggtgtgcccacctgt
ttctatgacaccatccctaagtatgctcccagtaatattcagtattcacccactggcatc
accacagaccttacccacctgacagcccctgagtcagctcgagcagcagcaccatcacca
cggagcacgcgacatacacctgcagcagcagccgccacctctcaccctctttctgcagag
atcagctcccttaggatcagcgtgatctaccacacggaaagcatgctgcagttcaagatc
tatgatcccactaataaaaggtatgaggtcccagtgcctctgaacactccttcctctcct
gttggctcgcctgaaaaccgtctgtatgatgtcaggattcaaaaccatcctttcgggatc
cagattcaacgaaaaagctccagcactttcaagaagaattcctatggtgtccacccctac
tacatgggactggaggaggatggcaatgcccatggagtgcttctgctaaacagtaatgcc
atggatgtgacattccagcctactcctgccctgacataccgcaccacaggagggattttg
gacttttatgtatttttggggccaactcccgagcttgtaactcagcaatacactgagttg
attggtcggccagcaatgatttcatactgggccttgggattccagctgagtcgctatgga
taccagagtgatactgaaatctccaatttgtatgatgaaatggtggaagcccagattccc
tatgatgttcagcatgtagacatcgattacatggaccggaagctggattttaccctcagc
accagctttcaaaaccttagtctgctgatggagcgaatgaagaaaaatggcacaagattt
gtccttgttctgaatccaggcatttctcgcaatgagaccaagtatctcccattcaccaca
gggcaggaaaacaatgtattcatcaaatggcctaacagcagtgacattgtctggggagag
gtaaggattgggaggagatgcctataattaatcagcatcacaatagacccagtgtgagag
cctgtgttactcttccagatgtacaaagcccacattgcatatcctgacttcctgcgtaac
agcacagctgcttggtggaaggaggaaataaaaaagctttacacaaacccaaagagcttg
aagttcgatggactgtggatcgataagaatgagccatcaaactttgtggatggatctgtc
agtggctgccgtgatgaaattcttaataagccaccgtatatgccatatttggagtccagg
gacaggggtctcagcagcaagaccctgtgcatggagagcgagcagatcctgcccgacggc
tcccgggtgcggcactacgatgtgcacagcctgtacgggtggtcccagaccagacccaca
tacgaagctgtgcaggaggtgactgatcagcgaggggtcgtcattacccgctccacgttc
ccctcttctggccgctgggcaggacactggctgggagacaacacggctgcatgggaccag
ctgaggaagtctatcattggcatgatggagttcagtctctttggaataccttatacagga
gcaaatatctgtggattcttgggaaatgctgaatatgagatgtgtcttcgctggatgcaa
ctgggggcattttatccattttccagaaaccacaacaccatcgggacaaggagacaagat
cctgtggcctggaattcaacctttcagacgtactcaagaaaagtcctccagaccagatac
accctgctgccttacctctatactctgatgcacaaagctcacgttgagggcagcactgtt
gtccgccctctcctccatgagtttagagaagataggacaacgtgggatatagaccgtcag
ttcatgctgggccctgccgtcttaatcagccccgtgctgacaagtaacacttttgaggtc
catgcttatttccccagagcccgttggtatgactatagcatggaatctggcaatacatcg
acaggtgagtggagaatcctggaggctccccttgaccacatcaaccttcatatcagagga
ggctacatcttgccttggcaagaggctgcaatgaacactcactccagtcgacagctattt
atgggattgattgttgctttggatgacaatgggaacgctgaaggtcagatgttctgggat
gatggacaaagcattgatacctatgaaaatggaaactattttttggcaaactttacagca
agtcagaacatattgcaaatccagaccatgcacaataagtatttgaatgattcaaatcaa
ctgaaagttggatatattaaaatctgggggatccattctacttatgtgacacaagtcaat
gtcacctatgacaacaagcaattcacgacaacgaatttcatgagtgacccctacaatcag
acactaactattcaactgattgacaagattttcagtctggaaaagttaactgaggtcact
tggagtcaccatgttcccgatgttactactacacctatgacgagtaccttctcatcaaca
tctccagatcctacatctactattattgctaccatttctgagtctattgtcactagtttt
gcttcaagtactagttctgctagcaatagtacagcctctcctattataaccacttctttc
ccaacaagtactattgaagatacacctggtactattgttcctaatactcctttccctaca
aatactaccactgctagcactggtactgcctttcctatcacaaccactaatacaactact
ccttttcctacaactactcctttccctacaaatactaccactgaaatcactggtactgcc
tttcctatcacaaccactaatacaactactccttttcctacaactactcctttccctaca
aatactaccactgaaatcactggtactgcctttcctatcacaaccactaatacaactact
ccttttcctacaactactcctttccctacaaatactaccactgaaatcactggtactgcc
tttcctatcacaaccactaatacaactactccttttcctacaactactcctttccctaca
aatactaccactgaaatcactggtactgcctttcctatcacaaccactaatacaactact
ccttttcctacaactactcctttccctacaaatactaccactgaaatcactggtactgcc
tttcctatcacaaccactaatacaactactccttttcctacaactactcctttccctaca
aatactaccactgaaatcactggtactgcctttcctatcacaaccactaatataactact
ttccctacagccactcctttccctacaactactaccactgttagcactggtactgccttt
cctatcccaaccactaatacaactactccttaccctacaaatactaccactgaaatcact
ggtactgcctttccttccacaaccactaatacaactactccttaccctacaaatactacc
actgaaatcactggtactgcctttccttccacaaccactaatacaactactccttaccct
acaaatactaccactgaaatcactggtactgcctttccttccacaaccactaatacaact
actcctttccttacaactactaccactgctagcactggtactgcctttcctatcacaacc
actaatacgactactcctttccctaaaactactcccactgctatcactggtactgccttt
cctttcacaaccactaatacaactactcctttccctacaaatactaccactgctagcact
ggtactgcctttcctatcacaaccactaatacaactactcctttccctacaaatactact
aatactaccactggtactgctggtcttattaccactcctctttccccaacagataccaat
gctactagcactaataatacgcttccgattacaactattccttctcttacaaatactgag
actgatactactagcatggattcagttactacaaatgttttaaatactaccactgctaga
aacacaaaaacaactacagctatcacaacagttactttaataacaaatggtacttctgaa
caaactactacagtgatcatgtcaactctacctcctacaggcacccttggtatcaccacc
acagataatgcactgaccagaatcagtaccactacttatcctccagatacccctacccat
gctttaagtaccacatccaggagcactcaaagcaccaccaatacaaatattaccaatatg
acaactggtgttactgacattataaatactcccactagaaacagctcagctactactgat
acaataattactagtactcaagacatttccacttcctcacatatgaacattacagatatt
aaatctactactaaagttactggaaatgccatcacagcgtatactaccaccatcactaca
tctgttttcagcacaaaaactgcaaattcaaacactacttctgacaccatccttacaaac
acttacattccaagtaccacagctattcccaccaccaatactatgaacactacagagcat
tcagaaaatattgctgatgaagataactccaggagtgtttttattccaaatactacagta
gcctcagattcattaacaccttttctagatacagcaactcaccatcatgtaacaacaaat
tctacaaccagttttttacctcttattgtaactaatgcgaccacggctattacgaatgtt
accatttatgcttcaaatactagtattcctgatagaacaccaatggatgcctctactcct
gcatcgtcttatattgcaaacaccacaaatactactgtagttccctga

DBGET integrated database retrieval system