KEGG   Myotis brandtii (Brandt's bat): 102262755Help
Entry
102262755         CDS       T02920                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00500  Starch and sucrose metabolism
myb01100  Metabolic pathways
myb04151  PI3K-Akt signaling pathway
myb04152  AMPK signaling pathway
myb04910  Insulin signaling pathway
myb04922  Glucagon signaling pathway
myb04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102262755 (GYS1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    102262755 (GYS1)
   04152 AMPK signaling pathway
    102262755 (GYS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102262755 (GYS1)
   04922 Glucagon signaling pathway
    102262755 (GYS1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    102262755 (GYS1)
Enzymes [BR:myb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102262755 (GYS1)
Glycosyltransferases [BR:myb01003]
 Polysaccharide
  Storage polysaccharide
   102262755 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 102262755
NCBI-ProteinID: XP_014405913
LinkDB All DBs
Position
Un
AA seq 637 aa AA seqDB search
MPLSRTLSVSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFATVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADIFLEALARLNYLLRVNNSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEHFTYEPHEADTVSWRGSL
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcagccgcactttgtccgtgtcctcgctgccgggactggaagattgggaggat
gaattcgacctggagaacacggtgctcttcgaagtggcctgggaggtggccaacaaagtg
ggcggcatctacacggtgctgcagacgaaggcgaaggtgacaggagatgagtggggtgac
aactactacctggtgggaccgtacacggagcagggcgtgaggacccaggtggagctgctg
gagcccccgaccccggctctgaagaggacgctggactccatgaacagcaagggctgcaag
gtgtattttgggcgctggctgatcgaagggggccccctggtggtgctcttggatgtggga
gcttcagcctgggccctggagcgctggaagggggagctctgggacacctgcaacatcggg
gtgccctggtacgaccgcgaggccaacgacgccgtcctttttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagagcgaggagaagccacacgtggtggcacacttccac
gaatggctggcgggggtcgggctctgcctgtgccgggcccggcggctgcctgtggctacc
atcttcaccacccacgccacgctgctggggcgatacctgtgtgccggtgccgtggacttc
tacaacaacctagagaacttcaatgtggacaaggaagcaggtgagaggcaaatctatcac
cgctactgcatggagcgggcagcagcccactgcgctcatgtcttcgctactgtgtcccag
atcaccgccatcgaggctcagcaccttctcaagaggaaaccagatatcgtgacccccaac
ggactgaacgtgaagaagttctctgccatgcacgagttccagaacctccatgctcagagc
aaggcccggatccaggagtttgtgcggggccatttttatgggcacctggacttcaacttg
gacaagacgttgtacttcttcatcgccggccgctacgagttctccaacaagggggccgac
atcttcctggaggccttggcccggctcaactatctgctcagagtcaacaacagtgagcag
accgtggtcgccttcttcatcatgcccgcgcggaccaacaacttcaacgtggaaaccctc
aagggccaggcggtgcgcaagcagctttgggatacggccaacacagtgaaggagaaattc
ggaaggaagctttatgaatccttgctggtggggagcctcccagacatgaacaagatgctg
gacaaggaggacttcaccatgatgaagagagccatctttgccacgcagcggcagtctttc
ccccctgtgtgcacccacaatatgctggacgactcctcagaccctatcctgaccaccatt
cgccgaattggcctcttcaatagcagcgccgacagggtcaaggttattttccacccggag
ttcctgtcctccaccagccccctgctgcccgtggactacgaggagttcgtccgtggctgc
cacctcggggtcttcccctcctactacgagccttggggctacacgccggctgagtgcacg
gttatgggcatccccagcatctccaccaacctctccggcttcggctgcttcatggaggag
cacatcgcagacccctcggcatacggcatctacattctggaccggcggttccgcagcctg
gatgattcctgctcgcagctcacctccttcctctacagcttctgccagcagagccggcgt
cagcgcatcatccagcggaaccgcaccgagcgcctctccgaccttctggactggaaatac
ttgggccggtactatatgtctgcgcgccacatggccctggccaaggcctttccagagcac
ttcacctacgagccccacgaggctgacacggtgagttggcgggggtccctctag

DBGET integrated database retrieval system