KEGG   Myotis brandtii (Brandt's bat): 102263790
Entry
102263790         CDS       T02920                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb01523  Antifolate resistance
myb04010  MAPK signaling pathway
myb04014  Ras signaling pathway
myb04024  cAMP signaling pathway
myb04062  Chemokine signaling pathway
myb04064  NF-kappa B signaling pathway
myb04066  HIF-1 signaling pathway
myb04071  Sphingolipid signaling pathway
myb04137  Mitophagy - animal
myb04151  PI3K-Akt signaling pathway
myb04210  Apoptosis
myb04211  Longevity regulating pathway
myb04218  Cellular senescence
myb04380  Osteoclast differentiation
myb04620  Toll-like receptor signaling pathway
myb04621  NOD-like receptor signaling pathway
myb04622  RIG-I-like receptor signaling pathway
myb04623  Cytosolic DNA-sensing pathway
myb04625  C-type lectin receptor signaling pathway
myb04657  IL-17 signaling pathway
myb04658  Th1 and Th2 cell differentiation
myb04659  Th17 cell differentiation
myb04660  T cell receptor signaling pathway
myb04662  B cell receptor signaling pathway
myb04668  TNF signaling pathway
myb04722  Neurotrophin signaling pathway
myb04917  Prolactin signaling pathway
myb04920  Adipocytokine signaling pathway
myb04926  Relaxin signaling pathway
myb04931  Insulin resistance
myb04932  Non-alcoholic fatty liver disease
myb04933  AGE-RAGE signaling pathway in diabetic complications
myb05010  Alzheimer disease
myb05022  Pathways of neurodegeneration - multiple diseases
myb05030  Cocaine addiction
myb05132  Salmonella infection
myb05133  Pertussis
myb05134  Legionellosis
myb05135  Yersinia infection
myb05140  Leishmaniasis
myb05142  Chagas disease
myb05145  Toxoplasmosis
myb05146  Amoebiasis
myb05152  Tuberculosis
myb05160  Hepatitis C
myb05161  Hepatitis B
myb05162  Measles
myb05163  Human cytomegalovirus infection
myb05164  Influenza A
myb05165  Human papillomavirus infection
myb05166  Human T-cell leukemia virus 1 infection
myb05167  Kaposi sarcoma-associated herpesvirus infection
myb05168  Herpes simplex virus 1 infection
myb05169  Epstein-Barr virus infection
myb05170  Human immunodeficiency virus 1 infection
myb05200  Pathways in cancer
myb05202  Transcriptional misregulation in cancer
myb05203  Viral carcinogenesis
myb05212  Pancreatic cancer
myb05215  Prostate cancer
myb05220  Chronic myeloid leukemia
myb05221  Acute myeloid leukemia
myb05222  Small cell lung cancer
myb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
myb05321  Inflammatory bowel disease
myb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102263790 (RELA)
   04014 Ras signaling pathway
    102263790 (RELA)
   04064 NF-kappa B signaling pathway
    102263790 (RELA)
   04668 TNF signaling pathway
    102263790 (RELA)
   04066 HIF-1 signaling pathway
    102263790 (RELA)
   04071 Sphingolipid signaling pathway
    102263790 (RELA)
   04024 cAMP signaling pathway
    102263790 (RELA)
   04151 PI3K-Akt signaling pathway
    102263790 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102263790 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    102263790 (RELA)
   04218 Cellular senescence
    102263790 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102263790 (RELA)
   04621 NOD-like receptor signaling pathway
    102263790 (RELA)
   04622 RIG-I-like receptor signaling pathway
    102263790 (RELA)
   04623 Cytosolic DNA-sensing pathway
    102263790 (RELA)
   04625 C-type lectin receptor signaling pathway
    102263790 (RELA)
   04660 T cell receptor signaling pathway
    102263790 (RELA)
   04658 Th1 and Th2 cell differentiation
    102263790 (RELA)
   04659 Th17 cell differentiation
    102263790 (RELA)
   04657 IL-17 signaling pathway
    102263790 (RELA)
   04662 B cell receptor signaling pathway
    102263790 (RELA)
   04062 Chemokine signaling pathway
    102263790 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102263790 (RELA)
   04917 Prolactin signaling pathway
    102263790 (RELA)
   04926 Relaxin signaling pathway
    102263790 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102263790 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102263790 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    102263790 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102263790 (RELA)
   05202 Transcriptional misregulation in cancer
    102263790 (RELA)
   05203 Viral carcinogenesis
    102263790 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102263790 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102263790 (RELA)
   05221 Acute myeloid leukemia
    102263790 (RELA)
   05220 Chronic myeloid leukemia
    102263790 (RELA)
   05215 Prostate cancer
    102263790 (RELA)
   05222 Small cell lung cancer
    102263790 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102263790 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102263790 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    102263790 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    102263790 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102263790 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102263790 (RELA)
   04931 Insulin resistance
    102263790 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102263790 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102263790 (RELA)
   05135 Yersinia infection
    102263790 (RELA)
   05133 Pertussis
    102263790 (RELA)
   05134 Legionellosis
    102263790 (RELA)
   05152 Tuberculosis
    102263790 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102263790 (RELA)
   05170 Human immunodeficiency virus 1 infection
    102263790 (RELA)
   05162 Measles
    102263790 (RELA)
   05164 Influenza A
    102263790 (RELA)
   05161 Hepatitis B
    102263790 (RELA)
   05160 Hepatitis C
    102263790 (RELA)
   05168 Herpes simplex virus 1 infection
    102263790 (RELA)
   05163 Human cytomegalovirus infection
    102263790 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102263790 (RELA)
   05169 Epstein-Barr virus infection
    102263790 (RELA)
   05165 Human papillomavirus infection
    102263790 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102263790 (RELA)
   05145 Toxoplasmosis
    102263790 (RELA)
   05140 Leishmaniasis
    102263790 (RELA)
   05142 Chagas disease
    102263790 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102263790 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:myb03000]
    102263790 (RELA)
Transcription factors [BR:myb03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    102263790 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 102263790
NCBI-ProteinID: XP_014393535
LinkDB
Position
Un
AA seq 548 aa
MRPRPDLFPLIFPSEPAQAPGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKT
HPTIKIIGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLG
IQCVKKRDLEQAINQRIQTNNNPFQVPMEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLSP
VLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARG
SFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHR
IEEKRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSTSVPKPAPQPYPFTPSLST
INFEEFSPMVFSSGQIPNQPSALAPALVSAMTPALVQAPTPAPVPVLASASSLAQAVAPP
APKPTQAGEGTLTEALLHLQFDADEDLGALLGNNTDPAVFTDLASVDNSEFQQMLNQGVS
MAPHTAEPMLMEYPEAITRLVTGSQNPPDPAPAPLGAAGLANGLLTGDEDFSSIADMDFS
ALLSQISS
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgcggccccggcccgacctgttccccctcatcttcccctccgagcccgcccaggcgccg
ggcccctacgtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaag
tgcgagggccgctcggcgggcagtatccccggcgagaggagcaccgataccaccaagacc
caccccaccattaagatcattggctacacggggccggggacggttcgcatctctctggtc
accaaggaccccccgcaccggcctcacccccacgagctggtcgggaaagactgccgggat
ggcttctatgaggctgagctctgcccggaccgctgcatccacagcttccagaacctgggg
atccaatgtgtgaagaagcgggacctggagcaggccatcaatcagcgcatccagaccaac
aacaaccccttccaagttcccatggaagagcagcgcggagactacgacttgaatgctgtg
cggctctgcttccaggtgacagtgcgggacccatcaggcaggcccctccgcctgtcacct
gtcctctctcatcccatctttgacaaccgcgcccccaacacagcagagctcaagatctgc
cgagtgaaccgaaactctgggagctgcctcgggggggacgagatcttcctgctgtgtgac
aaggtgcagaaagaggacatcgaagtgtatttcacgggaccaggctgggaggcccgaggc
tccttttcacaagccgatgtacaccgacaagtggccattgtgttccggacacctccctat
gcagaccccagcctgcaggcccccgtgcgcgtctccatgcagctgcggcggccttcagat
cgggagctcagcgagcccatggaattccagtacttgccagacacagatgatcgtcaccgg
attgaggagaagcgcaaaaggacatatgagaccttcaagagcatcatgaagaagagtcct
ttcaatggacccaccgacccccggcctcctccccggcgcattgccgtgccttcccgcagc
tcaacttccgtccctaagccagctccccagccctatccctttacgccatccctcagcacc
atcaactttgaggagttttcccccatggtcttttcttctgggcagatcccaaaccaaccc
tcagccttggcaccagcccttgtctcagccatgacaccagctctggttcaggccccaacc
ccagcccctgtcccagtcctagcctcagcctccagccttgctcaggctgtggccccgcct
gcccccaagcccacccaggcaggggaaggaacactgacggaggccctcctacatctgcag
tttgatgctgatgaagacctgggggccctgctgggcaataatactgacccagccgtgttc
acggacctggcctccgtcgacaactctgagtttcagcagatgctgaaccagggtgtctct
atggctccccacacagcggagcccatgctgatggagtaccctgaggctataacacgcctg
gtgacagggtcccagaatcctcctgacccagctcctgctcccctgggggccgctggcctc
gccaacggcctcctcacaggggatgaagacttttcctccatcgcagacatggacttctca
gccctactgagtcaaatcagctcctaa

DBGET integrated database retrieval system