KEGG   Myotis brandtii (Brandt's bat): 102264084Help
Entry
102264084         CDS       T02920                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00052  Galactose metabolism
myb00500  Starch and sucrose metabolism
myb01100  Metabolic pathways
myb04142  Lysosome
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102264084 (GAA)
   00500 Starch and sucrose metabolism
    102264084 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102264084 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:myb04147]
    102264084 (GAA)
Enzymes [BR:myb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102264084 (GAA)
Exosome [BR:myb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102264084 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 NtCtMGAM_N DUF5110
Motif
Other DBs
NCBI-GeneID: 102264084
NCBI-ProteinID: XP_014383865
LinkDB All DBs
Position
Un
AA seq 854 aa AA seqDB search
CFFPPSYPSYRLGNLTATDTGYTASLTRAATTFFPKDILTLRLDVLLETESRLHFTYFPR
HRLPRGHCAPDRSQGPECVFSFTLSLLCQVSPLCQVSPLCQLCQVSPLCQLCPVSPLCQL
CPVSPLCQLCPVSPLCQVSPLCQVSPLCQLCPVSPLCQLCPVSPLCQLCQVSPLCQVSLL
CKLCQMSPLCQLCPVSPLCQLCPVSPLCPVSPLCQLCPPNAVSSASQPDVNLYGSHPFYL
ALEDGGLAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYVFLGPEPKSVVQQYLEVIG
GPAPEACVQVPAPRGFALRRGLMPTSPTGAKTCLSFSTRFPRPQDPAISSSGPAGSYRPY
DEGLRRGVFITNETGQPLIGKVWPGPTAFPDFTNPEALDWWQDMVAEFHAQVPFDGMWID
MNEPSNFVKGSVDGCPDNELENPPYVPGVVGGSLRAATICASSRQFLSTHYNLHNLYGLT
EALASHRALVKVRGTRPFVISRSTFAGHGQYAGHWTGDVWSSWEQLSSSVPETLLFNLLG
VPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNDLHSLVQEPYRFSETAQQAMRKA
LGLRYALLPHLYTLFHDAHTRGDTVARPLFLEFPEDPRTWPVDRQLLWGEALLITPVLEA
GKVEVTGYFPAGTWYDLQTVPVEAFGSLPPPPLAPLKPAIHSEGQWVTLPAPLDTINLHL
RAGHIIPLQGPGLTTTESRKQPMALAVALTSSGEARGELFWDDGESLGVLERGAYTQLVF
LARNNTVVNDLVHVSSEGAALQLRRVTLLGLASAPKQVLANGVPVSNFTYSPDTQTLDIP
VSLTMGQQFLISWS
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
tgcttcttcccgcccagctacccgagctacaggctggggaacctgaccgccacggacacg
ggctacacggccagcctgacccgcgccgcaacgaccttcttccccaaggacatcctcacc
ctgcggctggacgtgctgctggagacggagagccggctgcacttcacgtacttcccccgc
caccgcttaccgagagggcactgcgcaccggacaggagccagggcccggagtgcgttttc
tcattcaccctgagcctgctgtgccaggtgagcccactgtgccaggtgagcccactgtgc
cagctgtgccaggtgagtccactgtgccagctgtgcccagtgagcccgctgtgccagttg
tgcccggtgagcccactgtgccagctgtgcccggtgagcccactgtgccaggtgagcccg
ctgtgccaggtgagcccactgtgccagctgtgcccggtgagcccgctgtgccagttgtgc
ccggtgagcccactgtgccagctgtgccaggtgagcccactgtgccaggtgagcctgctg
tgcaagctgtgccagatgagcccgctgtgccagttgtgcccggtgagcccactgtgccag
ctgtgcccggtgagtccactgtgcccggtgagcccgctgtgccagctgtgcccgcccaac
gctgtgtcctctgcgtcccagcccgacgtgaacctgtacgggtcccaccctttctacctg
gcactggaggacggcgggctggcccacggggtcttcctgctgaacagcaacgccatggac
gtggtcctgcagcccagcccagccctcagctggaggtcgacaggcgggatcctggacgtg
tacgtcttcctgggcccggagcccaagagtgtggtgcagcagtacctggaggtcataggt
gggcctgctcccgaagcctgtgtccaggtgcccgcaccacgcggcttcgccctgcgacgg
ggcctcatgcccacctcccccactggtgccaagacttgcctttccttctccacccgcttc
ccccgcccccaggatcccgccatcagcagctctggccccgcggggagctaccggccctac
gacgaggggctgcggaggggggtgttcatcaccaacgagaccgggcagcccctgatcggg
aaggtgtggccagggcccaccgccttccccgacttcaccaaccccgaggccctggactgg
tggcaggacatggtggctgagttccacgcccaggtgcccttcgacggcatgtggatcgac
atgaacgagccgtccaactttgtgaagggctccgtggacggctgccccgataacgagctg
gagaacccgccctacgtgcctggggtggtgggcgggtccctccgggcagccaccatctgt
gcctccagccgccagtttctctccacgcactacaacctgcacaacctgtacggcctgacc
gaggccttggcctcccacagggccctggtgaaggttcgggggacacgccccttcgtcatc
tcccgctccaccttcgccggccacggccaatacgccggccactggacaggggacgtgtgg
agcagctgggagcagctgtcctcgtcggtgccggaaaccctgctcttcaacctgctgggg
gtgcccctggtgggggccgacgtctgcggcttcctgggcaacacgtcggaggagctgtgc
gtgcgctggacacagctgggggccttctaccccttcatgcggaaccacaacgacctgcac
agcctggtacaggagccgtacaggttcagcgagacggcgcagcaggccatgcggaaggct
ctgggcctgcgctacgcgctgctgccccacctctacacgctcttccacgatgcccacacc
cgtggcgacaccgtggcccggcccctcttcctggagttccccgaggacccccgcacctgg
ccggtggaccgccagctcctgtggggagaggccttgctcatcacaccggtgctcgaggct
gggaaggtggaagtgactggctacttccccgccggcacgtggtacgacctgcagacggtg
ccagtagaggcctttggcagcctcccgcctccacctctggcacccctcaagcctgccatc
cacagcgagggccagtgggtgacgctgccggcccccctggacaccatcaacctccacctc
cgggctggacacatcatccccctgcagggccctggcctcacgaccacggagtcgcgcaag
cagcccatggcgctggccgtggccctgacctcgagcggggaggcccgcggggagctcttc
tgggatgacggggagagcctgggggtgctggagcgtggggcctacacacagctcgtcttc
ctggccaggaataacaccgtcgtgaacgacctggtgcacgtgagcagcgagggggccgcc
ctgcagctgaggagggtgaccctcctgggcctggcctcggcccccaagcaggtccttgcc
aatggggttcctgtctccaacttcacctacagccccgacacccagaccctggacatccct
gtctcgctgacgatgggacagcagtttctcatcagctggtcttga

DBGET integrated database retrieval system