KEGG   Myotis brandtii (Brandt's bat): 106725376Help
Entry
106725376         CDS       T02920                                 

Definition
(RefSeq) C-type lectin domain family 6 member A-like
  KO
K17514  C-type lectin domain family 6 member A
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:myb00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106725376
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:myb04054]
    106725376
   04091 Lectins [BR:myb04091]
    106725376
Pattern recognition receptors [BR:myb04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   106725376
Lectins [BR:myb04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Macrophage receptos
    106725376
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 106725376
NCBI-ProteinID: XP_014391726
LinkDB All DBs
Position
Un
AA seq 124 aa AA seqDB search
MMVVQGQPQGRERPVWWSPVKIWSVAVVSTAFLSACFIVSCVATYHITYTNTDRRLSELH
TYHPSLTCFNEGTRVTGFSCPIESFLFLFFVNCGAGTSGEKNIIASILFSSQQLEALLYQ
QLEF
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgatggtggtacaagggcaacctcaaggtagagaaaggccagtatggtggtcccccgtg
aagatctggtctgttgctgtggtttccacagcattcctcagtgcttgtttcatcgtgagt
tgtgtggcgacttatcatattacatatacaaacactgacagaaggctgtctgaattacat
acatatcatccaagtctaacctgcttcaatgaagggacaagggtgacaggcttttcttgt
cccattgagagttttttgtttttgttttttgtcaattgtggagctggcacttctggggag
aaaaacataattgcatcaatattattttcctctcaacaacttgaggcactcctgtatcaa
caattggagttttaa

DBGET integrated database retrieval system