KEGG   Myotis davidii: 102751832Help
Entry
102751832         CDS       T02992                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
myd  Myotis davidii
Pathway
myd00052  Galactose metabolism
myd00500  Starch and sucrose metabolism
myd01100  Metabolic pathways
myd04142  Lysosome
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102751832 (GAA)
   00500 Starch and sucrose metabolism
    102751832 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102751832 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:myd04147]
    102751832 (GAA)
Enzymes [BR:myd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102751832 (GAA)
Exosome [BR:myd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102751832 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N DUF5110
Motif
Other DBs
NCBI-GeneID: 102751832
NCBI-ProteinID: XP_006753108
LinkDB All DBs
Position
Un
AA seq 751 aa AA seqDB search
PPFLPRDILTLRLDVLLETESRLHFTIKDPASRRYEVPLETPRVRGRCVASPALTSGGSG
GGGVGTRNGSPESPSASPRPAPGSSAGPLSPLSPSRLFPGSWGRTPFSRGSLSHPSVRCP
GPWGAGGHVSLSPRAAPPDVILQPSPALSWRSTGGILDVYVFLGPEPKSVVQQYLEVIGR
PFMPPYWALGFHLCRWGYPSTAVTLQVVENMTRAHFPLDVQWNDLDYMDARRDFTFNKDG
FGDFPAMVRELHQGGRRYVMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKV
WPGPTAFPDFTNPEALAWWQDMVAEFHAQVPFDGMWIDMNEPSNFVKGSVDGCPDNELEN
PPYVPGVVGGSLQAATICASSRQFLSTHYNLHNLYGLTEALASHRALVKVRGTRPFVISR
STFAGHGQYAGHWTGDVWSSWEQLSSSVPETLLFNLLGVPLVGADVCGFQGNTSEELCVR
WTQLGAFYPFMRNHNDLHSLPQEPYRFSETAQQAMRKALGLLARPLFLEFPEDPRTWPVD
RQLLWGAALLITPVLEAGKVEVTGYFPAGTWYDLQTVPAEALGSLPPPPAAPLKPAIHSE
GQWVTLPAPLDTINLHLRAGHIIPLQGPGLTTTESRKQPMALAVALTSSGEARGELFWDD
GESLGVLEHGAYTQLVFLARNNTVVNDLVHVSSEGAALQLRRVTLLGVASAPKQVLANGV
PVSNFTYSPETQTLDIPVSLTMGQQFLISWS
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
ccgcccttcctccccagggacatcctcaccctgcggctggacgtgctgctggagacggag
agccggctgcacttcacgatcaaagatcccgccagcaggcgctacgaggtgcccttggag
accccccgtgtccgcggccggtgtgtggcctctccagctctgacctcgggtgggagcgga
ggagggggggtagggaccagaaacgggagtcctgagtccccctcagcatctccccgtcct
gctccagggtcctcagcaggtcctctgagtcccctgtcccctagcaggctgttcccaggc
tcctgggggaggacccccttctccagaggtagtttgtcccacccatccgtgaggtgccca
gggccctggggggcaggcgggcatgtgtccctgagccccagggctgctcccccagacgtg
atcctgcagcccagcccagccctcagctggaggtcgacaggcgggatcctggacgtgtac
gtcttcctgggcccggagcccaagagtgtggtgcagcagtacctggaggtcataggccgc
cccttcatgccgccgtactgggccctgggcttccatctctgccgctggggctacccgtcc
accgccgtcaccctccaggtggtggagaacatgacgcgggcccacttccccctggacgtc
cagtggaacgacctggactacatggacgcccggagggacttcacgttcaacaaggacggc
ttcggggacttcccggccatggtgcgcgagctgcaccagggcggccggcgctacgtgatg
atcgtggatcccgccatcagcagctccgggcctgcggggagctaccggccctacgacgag
gggctgcgaaggggggtgttcatcaccaatgagactgggcagcccctgatcgggaaggtg
tggccagggcccaccgccttccccgacttcaccaaccccgaggccctggcctggtggcag
gacatggtggctgagttccacgcccaggtgcccttcgacggcatgtggatcgacatgaac
gagccgtccaacttcgtgaagggctccgtggacggctgccccgataacgagctggagaat
ccgccctacgtgcctggggtggtgggcgggtccctccaggcagccaccatctgtgcctcc
agccgccagtttctctccacgcactacaacctgcacaacctgtacggcctgaccgaggcc
ttggcctcccacagggccctggtgaaggttcgggggacacgccccttcgtcatctcccgc
tccaccttcgccggccacggccaatacgccggccactggacaggggacgtgtggagcagc
tgggagcagctgtcctcgtcggtaccggaaaccctgctcttcaacctgctgggggtgccc
ctggtgggggccgatgtctgcggcttccagggcaacacgtcagaagagctgtgcgtgcgc
tggacacagctgggggccttctaccccttcatgcggaaccacaacgacctgcacagcctg
ccgcaggagccatacaggttcagcgagacggcgcagcaggccatgcggaaggctctgggc
ctgctggcccggcccctcttcctggagttccccgaggacccccgcacctggccggtggac
cgccagctcctttggggagcggccttgctcatcacgccggtgctcgaggctgggaaggtg
gaagtgacgggctacttccccgccggcacgtggtacgacctgcagacggtgccagcagag
gcccttggcagcctcccgcctccgcctgcggcccccctcaagcctgccatccacagcgag
ggccagtgggtgacgctgccggcccccctggacaccatcaacctccacctccgggccgga
cacatcatccccctgcagggtcctggcctcacgaccacagagtcgcgcaagcagcccatg
gcgctggccgtggccctgacctcgagcggggaggcccgcggggagctcttctgggatgac
ggggagagcctgggggtgctggagcacggggcctacacacagctcgtcttcctggccagg
aataacaccgttgtgaacgacctggtgcacgtgagcagcgagggggccgccctgcagctg
aggagggtgaccctcctgggcgtggcctccgcccctaagcaggtccttgccaatggggtt
cctgtctccaacttcacctacagccccgaaacccagaccctggacatcccagtctcgctg
acgatgggacagcagtttctcatcagctggtcttga

DBGET integrated database retrieval system