KEGG   Myotis davidii: 102752037
Entry
102752037         CDS       T02992                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
myd  Myotis davidii
Pathway
myd01521  EGFR tyrosine kinase inhibitor resistance
myd04062  Chemokine signaling pathway
myd04066  HIF-1 signaling pathway
myd04068  FoxO signaling pathway
myd04217  Necroptosis
myd04550  Signaling pathways regulating pluripotency of stem cells
myd04630  JAK-STAT signaling pathway
myd04659  Th17 cell differentiation
myd04917  Prolactin signaling pathway
myd04920  Adipocytokine signaling pathway
myd04931  Insulin resistance
myd04933  AGE-RAGE signaling pathway in diabetic complications
myd04935  Growth hormone synthesis, secretion and action
myd05145  Toxoplasmosis
myd05160  Hepatitis C
myd05161  Hepatitis B
myd05162  Measles
myd05163  Human cytomegalovirus infection
myd05167  Kaposi sarcoma-associated herpesvirus infection
myd05169  Epstein-Barr virus infection
myd05200  Pathways in cancer
myd05203  Viral carcinogenesis
myd05205  Proteoglycans in cancer
myd05206  MicroRNAs in cancer
myd05212  Pancreatic cancer
myd05221  Acute myeloid leukemia
myd05223  Non-small cell lung cancer
myd05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
myd05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102752037 (STAT3)
   04066 HIF-1 signaling pathway
    102752037 (STAT3)
   04068 FoxO signaling pathway
    102752037 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102752037 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102752037 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102752037 (STAT3)
   04062 Chemokine signaling pathway
    102752037 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102752037 (STAT3)
   04917 Prolactin signaling pathway
    102752037 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    102752037 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102752037 (STAT3)
   05206 MicroRNAs in cancer
    102752037 (STAT3)
   05205 Proteoglycans in cancer
    102752037 (STAT3)
   05203 Viral carcinogenesis
    102752037 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102752037 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102752037 (STAT3)
   05221 Acute myeloid leukemia
    102752037 (STAT3)
   05223 Non-small cell lung cancer
    102752037 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102752037 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102752037 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102752037 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    102752037 (STAT3)
   05161 Hepatitis B
    102752037 (STAT3)
   05160 Hepatitis C
    102752037 (STAT3)
   05163 Human cytomegalovirus infection
    102752037 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102752037 (STAT3)
   05169 Epstein-Barr virus infection
    102752037 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102752037 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102752037 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:myd03000]
    102752037 (STAT3)
Transcription factors [BR:myd03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102752037 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 N6-adenineMlase E2R135 DUF4795 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 102752037
NCBI-ProteinID: XP_015426039
LinkDB
Position
Un
AA seq 769 aa
MSGLKYWFCLVFFLLCLGFFLLDGDFVCVQVSESFLITLSFPRAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPYLKTKFICVTPTTCSNT
IDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
NT seq 2310 nt   +upstreamnt  +downstreamnt
atgagtgggttaaagtattggttttgccttgtttttttcctcctttgccttggttttttc
ctccttgatggtgactttgtgtgtgtgcaggtttcagaatcattccttatcactctttct
tttcctagggcttatgcagccagcaaagaatcacatgcgactttggtgtttcataatctc
ttgggtgagattgaccagcagtacagccgcttcctacaagagtcaaatgttctctatcag
cacaatctgcgaagaatcaagcagttccttcagagcaggtatcttgagaagcctatggag
attgcccgaatcgtggcccggtgcctgtgggaagagtcccgcctcctccaaaccgcagcc
actgcagcccagcaagggggccaggccaaccaccccacagctgccgtggtgacagagaag
cagcagatgctggagcagcacctacaggacgttcggaagcgagtacaggatctagaacag
aaaatgaaagtggtagagaatctccaggatgactttgatttcaactataaaaccctcaag
agtcaaggagacatgcaagatctgaatggaaacaaccaatcggtgaccaggcagaagatg
cagcagctagaacagatgctaactgctctggaccagatgcggcgaagtatcgtgagtgag
ctggcggggcttttgtcagctatggagtatgtgcagaaaactctcacggatgaggagctg
gctgactggaagaggcggcaacagattgcttgcattggaggccctcccaacatctgctta
gatcgtctagaaaactggataacctcattagcagaatctcaacttcagacccgccaacaa
attaagaaactggaggagttgcagcaaaaagtttcctacaaaggggaccccattgtacag
caccggccaatgctggaggagagaattgtggaactctttagaaacttaatgaaaagtgcc
tttgtggttgagcggcagccctgcatgcccatgcatcccgaccggccattagtcatcaag
actggtgtccagtttactactaaagtcagattgctggtcaaattccccgagttaaattat
cagcttaaaattaaagtgtgcattgacaaagactctggggatgtagcagctctccgagga
tccaggaaatttaacattctgggcacaaacacaaaagtcatgaacatggaagaatccaac
aacggcagcctctctgcagaattcaaacacttgaccctgagagagcaaagatgtgggaat
gggggccgagccaattgtgacgcctccctgattgtgaccgaggagctgcacctgatcacc
tttgagacggaggtatatcaccaaggcctcaagattgacctagagacacactccctgcca
gtggtggtgatttccaacatctgtcagatgccaaatgcttgggcatccatcctgtggtat
aacatgctgaccaacaaccccaagaacgtgaactttttcacaaaacccccaattggaacc
tgggatcaggtggccgaggtgctgagctggcagttctcttccaccacgaagcgagggttg
agcatcgaacagttgactacgctggcagagaaactcctaggacctggtgtgaactattca
gggtgtcagatcacatgggcaaaattttgcaaagaaaacatggctggcaagggcttctcc
ttctgggtctggctggacaatatcattgaccttgtgaaaaagtacattctggccctttgg
aatgaagggtacataatgggctttatcagcaaggaaagagagagggccatcttgagcacc
aagcccccaggtaccttcctgctaagattcagtgaaagcagcaaagaaggaggtgtcacc
ttcacttgggtggagaaggacatcagcggtaagacacagatccagtcggtggaaccatat
actaagcagcagctgaacaacatgtcattcgcggaaatcatcatgggctataagatcatg
gatgctaccaatatcctggtgtctccactggtctatctctaccccgacattcctaaggag
gaggcgttcggaaagtattgtcggccagagagccaggagcatcctgaggctgacccaggt
gctgccccctacctgaagaccaagttcatctgtgtgacaccaacgacctgcagcaatacc
attgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataatggt
gaaggtgctgaaccctcagcaggagggcagtttgagtccctcacattcgacatggagctg
acctcagagtgcgctacctcccccatgtga

DBGET integrated database retrieval system