KEGG   Myotis davidii: 102752127Help
Entry
102752127         CDS       T02992                                 

Gene name
AGER
Definition
(RefSeq) advanced glycosylation end-product specific receptor
  KO
K19722  receptor for advanced glycosylation end products
Organism
myd  Myotis davidii
Pathway
myd04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:myd00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102752127 (AGER)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2-set_2 Ig_3 Ig_2 ig I-set V-set Ig_4 Ig_5 C2-set
Motif
Other DBs
NCBI-GeneID: 102752127
NCBI-ProteinID: XP_015425343
LinkDB All DBs
Position
Un
AA seq 490 aa AA seqDB search
MGAGERVQAPPRAVATAARGRQPGAWTGGRMAAGATAGAWVLVLGLWGEPLPPPVEGARP
LPGLPWTLTLLQFPCPPCASLTRPLPPAPPPCCPLPGTVAGCQNVTAPIGKPLVLKCKGA
PRKPPQQLEWKLHTGRTEAWKVLSPQGSPWDSVARVLPNGSLLLPAVGIPDEGTFRCRAM
SRKGKEIKSNYQVRVYQIPGKPEIVDPVSELKAGVPNKVGTCVSEGGYPAGTLSWHLDGK
PLIPDGKGVSVKEETRRHPETGLFTLQSELTVTPVQGGAPHPSFSCSFSPGRPRRRALHT
APIQLSVQGEPRAPEPVPPEVQLVVEPEGGAVAPGGTVTLTCEASSQPPPQIHWVKDGTP
LPLPPSPVLLLPEVGPQDQGTYSCVATHPSHGPQESRAVSISIIETGEEGPTAGEXXXXX
LGTIALALGILGGLGAAALLIGVIVWQRRRRRGEERKAPENREEEEERAELRQSQEPDAA
ESSAGGASHK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgggggcaggggagagggtacaagccccacctagggcagtggccacagcagcgagaggc
agacagccaggagcctggacaggaggcaggatggcggcaggggcaacggctggagcctgg
gtgctggtcctcggtctgtggggtgagccactgcccccacctgtggaaggcgctcggccc
ctcccaggtcttccctggaccctcacgctcctccagttcccttgcccaccctgtgccagt
ctcaccagaccgctccctccagcccctccaccttgctgccctctcccagggacagtggca
ggctgtcaaaacgtcacagccccgatcgggaagccgctggtgctcaagtgtaagggtgct
cccaggaaaccaccccagcagctggaatggaaactgcacacaggcaggacagaagcctgg
aaggtcctgtctccccagggaagcccctgggacagcgtggctcgagtcctccccaatggc
tccctcctcctgccggctgtggggatcccggatgaggggactttccggtgccgggccatg
agccggaaaggaaaggagatcaagtccaactaccaagtccgagtctaccagatccctggg
aagccagaaattgtcgatcccgtctcggaactcaaggctggtgtccccaataaggtgggg
acatgtgtgtctgaggggggctaccctgcagggactcttagctggcacttagacgggaag
cccctgatacctgatggcaaaggcgtgtctgtgaaggaagagaccaggagacaccctgag
acggggcttttcacactccagtcagagctgacggtgaccccagtgcaggggggagcgccc
cacccctccttctcctgtagcttcagccccggccgtccccggcgcagagccctgcacaca
gcccccatccagctcagcgtccagggcgagcccagagccccggagcctgtgcctccagag
gtccagctggtggtggagccggaaggcggagcagtggctcctggtggtactgtgaccctg
acctgtgaagcctcctcccagccccctcctcaaatccactgggtcaaggacggcaccccc
ctgccccttccccccagtccagtgctgctcctccctgaggtagggcctcaggaccaagga
acctacagctgtgtggccacccaccccagccacgggccccaggagagccgtgctgtcagc
attagcatcatcgaaacaggcgaggaggggccaactgcaggtgagnnnnnnnnnnnnnng
ctgggaactatagccctggccctggggatcctgggaggcctgggggcagccgccctgctc
attggggtcatcgtgtggcaaaggcgccgccgccgaggagaggagaggaaggccccagaa
aaccgggaggaggaggaggagcgggcagagctccgtcagtcccaggagcccgatgccgcc
gagagcagcgcaggaggagcctcccacaaatag

DBGET integrated database retrieval system