KEGG   Myotis davidii: 102753022Help
Entry
102753022         CDS       T02992                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
myd  Myotis davidii
Pathway
myd00040  Pentose and glucuronate interconversions
myd00051  Fructose and mannose metabolism
myd01100  Metabolic pathways
Module
myd_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102753022 (SORD)
   00051 Fructose and mannose metabolism
    102753022 (SORD)
Enzymes [BR:myd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     102753022 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 102753022
NCBI-ProteinID: XP_006778054
LinkDB All DBs
Position
Un
AA seq 355 aa AA seqDB search
MAAKPENLSLVVHGPGDLRLENYPIPEPGPNEVLLKMHSVGICGSDVHYWQHGRIGDFIV
KKPMVLGHEASGTVVKVGSLVKHLQQGDRVAIEPGAPREIDEFCKIGRYNLSPTIFFCAT
PPDDGNLCRFYKHDANFCYKLPDNVTFEEGALIEPLSVGIHTCRRAGVTLGNKVFVCGAG
PIGLVNLLVAKAMGAAQVVVTDLSASRLAKAKEAGADFVLQITNESPQEIASKVEGLLGC
KPEVTIECTGAEAAIQAGIYATCPGGTLMLVGLGSEMVNVPLVHAAIREVDIKGVFRYCN
TWPMAISMLASKSVNVKSLVTHRFPLEKALEAFETSKKGLGLKVMIKCDPNDQNP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaagcccgagaacctgtctctggtggttcacggacccggggacctgcgcctg
gagaactaccctattcctgaaccaggcccaaatgaggtgctgctgaagatgcattctgtt
ggaatctgcggctcagatgtccactactggcagcatggtcgaattggggattttattgtg
aaaaagccaatggttctgggtcatgaagcatcaggaacagtcgtaaaagtggggtcattg
gtaaagcacctacaacaaggcgatcgcgttgccatcgagcctggtgctccccgagaaatc
gatgaattttgcaagattggccgatacaacctgtcaccaaccatcttcttctgtgccacg
ccccccgatgatgggaacctctgccggttctataagcacgatgccaacttctgctacaag
cttcctgacaatgtcacctttgaggaaggggccctgattgagccactgtctgtggggatc
catacctgccggcgagctggagtcaccctggggaacaaggtctttgtatgtggagctggg
ccaattggattggtcaatttgctggtggccaaggcaatgggcgcagctcaagtggtggtg
actgatctgtctgcctctcggttggctaaagccaaggaagctggggctgactttgtcctc
cagatcaccaatgagagcccgcaggaaatcgccagtaaagtggaaggcctcctggggtgc
aagccagaagtcaccatcgagtgcactggggcggaggccgccatccaggcgggcatctac
gccacttgtcctggtgggaccctgatgcttgtaggattgggttccgagatggtcaatgtg
cccctagtgcatgcagccatccgcgaagtggatatcaagggcgtgtttcgatactgcaac
acatggccgatggcgatttcaatgcttgcatccaagtctgtgaatgtcaagtctttagtg
acccataggtttcctctggagaaagcgctggaggcctttgaaacatccaaaaagggtttg
ggtctgaaagtcatgatcaagtgcgaccccaatgaccagaatccctga

DBGET integrated database retrieval system