KEGG   Myotis davidii: 102753287Help
Entry
102753287         CDS       T02992                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
myd  Myotis davidii
Pathway
myd00010  Glycolysis / Gluconeogenesis
myd00030  Pentose phosphate pathway
myd00051  Fructose and mannose metabolism
myd00052  Galactose metabolism
myd01100  Metabolic pathways
myd01200  Carbon metabolism
myd01230  Biosynthesis of amino acids
myd03018  RNA degradation
myd04152  AMPK signaling pathway
myd05230  Central carbon metabolism in cancer
Module
myd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102753287 (PFKP)
   00030 Pentose phosphate pathway
    102753287 (PFKP)
   00051 Fructose and mannose metabolism
    102753287 (PFKP)
   00052 Galactose metabolism
    102753287 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102753287 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102753287 (PFKP)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    102753287 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:myd01009]
    102753287 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:myd03019]
    102753287 (PFKP)
Enzymes [BR:myd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102753287 (PFKP)
Protein phosphatases and associated proteins [BR:myd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102753287 (PFKP)
Messenger RNA biogenesis [BR:myd03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102753287 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 102753287
NCBI-ProteinID: XP_006758212
UniProt: L5M7X8
LinkDB All DBs
Position
Un
AA seq 790 aa AA seqDB search
MDHNGDPSVPRASFRKFLEQLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYTGAKVYF
IYEGYQGMVDGGNNIVEANWESVSSILQVGGTIIGSARCKAFRTREGRLKAAHNLVQLGI
TNLCVIGGDGSLTGANIFRGEWSTLLEELARDGKISKEDVQKYGHLNIVGMVGSIDNDFC
GTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFL
PESPPEEGWQETMCFKLSENRARKKRLNIIIVSEGAIDTQNKPITSEQIRELVVKQLGYD
TRVTILGHVQRGGTPSAFDRILASRMGVEAVVALLQATPETPACVVSLNGNQAVRLPLME
CVQMTQGVQKAMDERRFSNAVQLRGRSFEGNLNIYKQLAIKKPDSQITKSGFNVAVINVG
APAAGMNAAVRSAVRVGISEGHKMFAIYDGFEGFAKGQIKEIGWSDVGGWTGQGGSILGT
KRILPAKYLEDIAAQMRTHSINALLIIGGFEGYLGLLELSAARGKHEEFCVPMVMVPATV
SNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAAG
ADAAYIFEEPFDIRDLQSNVEHLTEKMKTCIQRGLVIRNENCNENYTTDFIYQLYSEEGK
GVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMQWITGKLKEAQGKGRKFVNDDSVCV
LGICQRNLLFQPVAELKEKTDFEHRIPKEQWWLKLRPLMKILAKYKASYEVSDMSQLEHV
HTGPEEPAAI
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggaccacaacggtgacccctcggtccccagagcttccttccgaaagttcctggagcaa
ctctccggggccggcaaagccatcggcgtgctgaccagcggcggggatgcccaaggtatg
aatgctgctgtccgtgctgtcgtgcgcatggggatctacacgggggccaaggtgtacttc
atctatgagggctaccaaggcatggtggatggcggcaacaacatcgtggaagcaaactgg
gagagcgtctccagcatcctacaagtgggcgggaccattattggcagcgcccggtgcaaa
gccttccgtacccgggaaggccgcctgaaagctgcccacaacctggtgcagctgggcatc
accaacctgtgtgtaatcggcggggacggcagcctcacgggggccaacatcttccggggg
gagtggagcaccctgctggaggagctggcccgagacggcaagatcagcaaggaggatgtg
cagaagtacgggcacctcaacatcgtgggcatggtgggctccattgacaatgacttttgc
gggacagacatgaccatcggcactgactcggctttgcaccgcatcattgaggtcgttgat
gccatcatgacgacagcccagagccaccagaggaccttcgttctcgaggttatggggaga
cactgcgggtacctcgccttggtgagcgccttggcctgtggggcggactgggtgttcctc
ccggaatccccgccagaagagggttggcaggagacgatgtgcttcaagctgtcagagaac
cgggcccggaagaaaaggctgaatatcattattgtgtccgaaggagcaatcgacacccaa
aacaaaccgattacctcggagcaaatcagggagctggtggtgaagcagctgggatacgac
acccgcgtgaccatcctcggacacgtgcagagaggcgggacgccctcggcctttgacagg
attttggccagccgcatgggggtggaggccgtggtcgccctcctgcaggccacgccagag
accccggcctgcgtggtgtcgctgaacgggaaccaggctgtgcgcctgcccctgatggaa
tgcgtgcagatgacccagggcgtccagaaggcgatggatgagaggagattcagcaacgcc
gtgcagctccgaggaaggagctttgagggcaacctcaacatctacaagcagctcgccatc
aagaagccagactcccagatcaccaagagtggcttcaacgtggccgtcatcaacgtgggc
gcgccggctgccgggatgaacgcggccgtgcgctcggctgtgcgggttggcatctcagaa
ggacacaagatgtttgccatctatgatggcttcgagggctttgccaaaggccagatcaaa
gaaatcggctggtcggatgttggaggctggaccggacaaggcggctccattcttgggaca
aaacggatcctccctgcgaagtacttggaagacattgctgcacagatgcgcacccacagc
atcaacgcgctgctcatcattggggggtttgagggctacctggggctgctggaactgtca
gccgcccgggggaagcacgaggagttctgtgtccccatggtcatggttcccgccaccgtg
tccaacaacgtgccggggtctgatttcagcatcggtgccgacaccgctctgaacaccatc
actgacacgtgcgaccgcatcaagcagtccgccagcgggactaagcgccgcgtgttcatc
atcgagaccatgggcggctactgcggctacctggctaacatgggggccctggcggccggt
gcggacgccgcctacatcttcgaggagcccttcgacatccgggacctgcagtccaatgtg
gagcacctgacagagaagatgaagacctgcattcagaggggccttgtgatcagaaacgag
aactgcaatgagaactacaccaccgacttcatctaccagctctactcagaggagggcaaa
ggggtgttcgactgtaggaagaatgtgctgggccacatgcagcagggaggagcgccttcc
ccatttgacagaaacttcggaaccaaaatctccgcccgggccatgcagtggatcacgggg
aagctgaaggaggcgcaaggaaaaggaagaaagtttgtgaacgatgattccgtctgtgtg
ctgggaatatgccaaagaaaccttcttttccagcctgtggcagagctgaaggagaagacg
gactttgagcacagaattcccaaagagcagtggtggctgaagctgcggcccctcatgaag
atcctggccaagtacaaggccagctatgaggtctctgacatgagccagttggagcacgtt
cacaccggccccgaggagcctgcagccatctag

DBGET integrated database retrieval system