KEGG   Myotis davidii: 102753812
Entry
102753812         CDS       T02992                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
myd  Myotis davidii
Pathway
myd04010  MAPK signaling pathway
myd04020  Calcium signaling pathway
myd04022  cGMP-PKG signaling pathway
myd04024  cAMP signaling pathway
myd04260  Cardiac muscle contraction
myd04261  Adrenergic signaling in cardiomyocytes
myd04270  Vascular smooth muscle contraction
myd04713  Circadian entrainment
myd04720  Long-term potentiation
myd04723  Retrograde endocannabinoid signaling
myd04724  Glutamatergic synapse
myd04725  Cholinergic synapse
myd04726  Serotonergic synapse
myd04727  GABAergic synapse
myd04728  Dopaminergic synapse
myd04742  Taste transduction
myd04911  Insulin secretion
myd04912  GnRH signaling pathway
myd04921  Oxytocin signaling pathway
myd04924  Renin secretion
myd04925  Aldosterone synthesis and secretion
myd04927  Cortisol synthesis and secretion
myd04929  GnRH secretion
myd04930  Type II diabetes mellitus
myd04934  Cushing syndrome
myd04935  Growth hormone synthesis, secretion and action
myd05010  Alzheimer disease
myd05020  Prion disease
myd05022  Pathways of neurodegeneration - multiple diseases
myd05031  Amphetamine addiction
myd05410  Hypertrophic cardiomyopathy
myd05412  Arrhythmogenic right ventricular cardiomyopathy
myd05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102753812 (CACNA1C)
   04020 Calcium signaling pathway
    102753812 (CACNA1C)
   04024 cAMP signaling pathway
    102753812 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    102753812 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102753812 (CACNA1C)
   04929 GnRH secretion
    102753812 (CACNA1C)
   04912 GnRH signaling pathway
    102753812 (CACNA1C)
   04921 Oxytocin signaling pathway
    102753812 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    102753812 (CACNA1C)
   04924 Renin secretion
    102753812 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    102753812 (CACNA1C)
   04927 Cortisol synthesis and secretion
    102753812 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102753812 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    102753812 (CACNA1C)
   04270 Vascular smooth muscle contraction
    102753812 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    102753812 (CACNA1C)
   04727 GABAergic synapse
    102753812 (CACNA1C)
   04725 Cholinergic synapse
    102753812 (CACNA1C)
   04728 Dopaminergic synapse
    102753812 (CACNA1C)
   04726 Serotonergic synapse
    102753812 (CACNA1C)
   04720 Long-term potentiation
    102753812 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    102753812 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    102753812 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102753812 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102753812 (CACNA1C)
   05020 Prion disease
    102753812 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    102753812 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    102753812 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102753812 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102753812 (CACNA1C)
   05414 Dilated cardiomyopathy
    102753812 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102753812 (CACNA1C)
   04934 Cushing syndrome
    102753812 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:myd04040]
    102753812 (CACNA1C)
Ion channels [BR:myd04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102753812 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Etmic-2 DUF4834
Other DBs
NCBI-GeneID: 102753812
NCBI-ProteinID: XP_015419785
LinkDB
Position
Un
AA seq 2019 aa
MIMVIVAVVVMTVVVTVEMVVEVFIGDSGGGDSGDGGFEQVEYLFLIIFTVEAFLKVIAY
GLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGANALGGKGAGFDVKALRAFRV
LRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQ
EGIADVPAEDEPSPCALETGHGRQCQNGTVCKPGWDGPRHGITNFDNFAFAMLTVFQCIT
MEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDF
QKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVAG
GDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTI
ASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGIL
ETILVETKVMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLF
IIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGG
PSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLART
ASPEKKQEVVEKPAVEETKEEKIELKSITADGESPPTTKINMDDLQPNENEDKGVYPNPE
VTGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPSNRFRLQCHRIVNDSI
FTNLILFFILLSSISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLHK
GSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQC
VFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEV
DHPIIQPRNWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVE
ISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRR
YIPKNQHQYKVWYVVNSTYFEYLMFILILLNTICLAMQHYGQSCLFKNAMNVLNMLFTGL
FTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPTEQTQCSPSLNAEENS
RISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQV
FGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPHNST
EGEAPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIW
AEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNAT
LFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYAT
FLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDK
AMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDSRSTFPQTFTTQRPLHINKATNSPGDTE
SPSHEKLVDSTFTPSSYSSTGSNANINNANNTALGRFPRPTRYPSSVSGAVEGHGPPLSP
AIRVQEAAWKLSSKRCHSRESQIAMVCREEFSQDETYDVQMGDDAEYCSEPSLVSTDKLS
YQDEESRQLAPPEDRRDTRQSPKRGFLRSASLGRRASFHLECLKRQKNQGGDISQKTVLP
LHLVHHQALAVAGLSPLLQRSHSPTTFPRPCATPPATPSSRGWPPQPIPTLWLEGTESTE
KLNSSFPSVHCSSWAGEPTACEGGSSATRRARPVSLTVPSQAGAWGRQFHGSASSLVEAV
LISEGLGQFAQDPKFIEVTTQELADACDMTIEEMENAADNILSGGAQQSPNGTLLPFVNC
RDQGQDRAGGEEPGPCGPSQEPQRSEEELQDSRAYVSSL
NT seq 6060 nt   +upstreamnt  +downstreamnt
atgataatggtgattgtggcggtggtggtgatgacagtagtggtaacagtggagatggtg
gtggaggtgttcattggtgatagtggtggtggtgatagtggcgatggtggttttgaacaa
gtggaatatctctttctcatcatttttactgtggaagcatttttaaaagtaatagcctat
ggacttctctttcaccctaacgcttacctccgcaacgggtggaatttactagattttata
attgtggttgtagggctttttagtgcaattttagaacaagcaaccaaaggtgacggggca
aacgctctaggagggaaaggggctggatttgatgtgaaggcgctgagagcgttccgcgtg
ctgcgccccttgcggctggtgtccggagttccaagtctccaggtggttctgaattccatc
atcaaggccatggttcccctgctgcacatcgccctgctagtgctgtttgtcatcattatc
tatgctatcattggcctggaactcttcatggggaaaatgcataagacctgctacaaccag
gagggcatagcagatgttccagcagaagatgaaccctccccttgtgctctggagacaggc
catggacggcagtgtcagaatggcactgtgtgcaagcctgggtgggatgggcccaggcac
ggcatcaccaacttcgacaacttcgccttcgccatgctcacggtgttccagtgcatcacc
atggaaggctggacagacgtgctatactggatgcaggacgctatgggctatgagttaccc
tgggtgtattttgtcagtctggtcatctttggatcctttttcgttctaaatctggttctc
ggtgtgttgagcggagagttctccaaagagagggagaaggccaaggctcggggggatttc
caaaagctacgagagaagcaacaactggaagaggacctgaagggctacctggactggatc
acacaggcggaagacattgaccctgagaacgaggatgaaggcatggatgaggagaaaccc
cgaaacatgagcatgcccacaagtgagacggagtctgtcaacactgagaacgtggctggc
ggtgacatcgagggagaaaactgtggggccaggctggcccaccggatctccaagtcaaag
ttcagtcgctactggcgccggtggaatcggttctgcagaaggaagtgtcgtgccgcagtc
aagtccaatgtcttctactggcttgtgattttcctggtgttcctcaacacgctcaccatt
gcctcggagcattacaaccagccgcactggctcacagaagtccaagacacggccaacaag
gcgctcctggccctgttcactgcggagatgctgctgaagatgtatagcctgggcctgcag
gcctacttcgtgtccctcttcaaccgcttcgactgcttcattgtgtgcgggggcatcctg
gagaccatcctggtggagaccaaggtcatgtcccccttgggcatctctgtgctgagatgt
gttcggctcctgaggatatttaaaatcaccaggtactggaactccttaagcaacctggtg
gcatccttgctgaactccgtgcgctccatcgcctccctgctactactgctcttcctcttc
atcatcatcttctcccttctggggatgcagctctttggaggaaagttcaactttgatgag
atgcagactcggaggagcacgtttgataactttccccagtccctcctcacagtgtttcag
atcctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttatggcggc
ccctcttttccagggatgttagtctgtatttacttcatcatcctcttcatctgtggaaac
tatatcctactgaatgtgttcttggccattgctgtggacaacctggctgatgctgagagc
ctcacatctgcccagaaggaggaagaagaagagaaggagagaaagaagctggccaggact
gccagcccagagaagaaacaggaggtggtggagaaacccgcagtggaggagaccaaggag
gagaaaattgagctgaaatccattacagctgatggagagtccccgcccaccaccaagatc
aacatggatgacctccagcccaatgaaaatgaggacaagggtgtctaccccaacccggaa
gtgacaggagaggaggatgaggaggagcctgagatgcccgtgggcccacgcccacgccca
ctctcggagctgcacctcaaggaaaaggctgtgcccatgcctgaagccagtgcatttttc
atcttcagccccagcaacaggtttcgcctccagtgccaccgcattgtcaatgactcgatc
ttcaccaacctgatcctcttcttcatcctgctaagcagcatttccctggctgcggaggac
ccggtccagcacacctccttcagaaaccatatcctaggcaatgcagactatgtcttcact
agtatctttacattagaaattatccttaagatgactgcttatggggctttcttgcacaag
ggctccttttgccggaactacttcaacatcttggacctgctagtggtcagcgtgtccctc
atctcctttggcatccagtccagtgcaatcaatgttgtaaagatcttgcgagttctgcgt
gtactcaggcccctgagagccatcaaccgagccaaggggctaaagcatgtggtccagtgt
gtgttcgtggccatccgcaccatcgggaacatcgtgattgtcaccacgctgcttcagttc
atgttcgcctgcatcggggtccagctcttcaagggaaagctctacacctgttcagacagt
tccaagcagaccgaggcggaatgcaagggaaactacatcacgtacaaggacggggaggtt
gaccaccccatcatccagccccgaaactgggagaacagcaagtttgactttgacaatgtc
ctggcagccatgatggctctcttcactgtctccacctttgaggggtggccagagctgctg
taccgctccatcgactcccacacggaagacaagggccccatatacaactatcgcgtggag
atctccatcttcttcatcatctacatcatcatcattgccttcttcatgatgaacatcttc
gtgggttttgtcatcgtcaccttccaggagcagggagagcaggagtacaagaactgtgag
ctggacaagaaccagcgtcagtgtgtagaatatgccctcaaggcccgacccctgcggagg
tacatacccaagaaccagcaccagtacaaagtgtggtatgtggtcaactccacctacttt
gagtacctgatgttcatcctcatcctgctcaacaccatctgcttggccatgcagcactac
ggtcagagctgcctgtttaaaaacgccatgaacgtcctcaacatgctcttcactggcctc
ttcactgtggagatgattctgaagctcattgcctttaaacccaagggttactttagtgat
ccctggaatgtttttgacttcctcatcgtaattggcagcataattgacgtcattctcagt
gaaactaatccaactgaacaaacccaatgctctccctctctgaatgcagaggagaactcc
cgcatctccatcaccttcttccgcctcttccgggtcatgcgcctggtcaagctgctgagc
cgtggggagggcatccggacgctgctgtggaccttcatcaagtccttccaggccctgccc
tacgtggcccttctaatcgtgatgctgttcttcatctatgctgtgatcgggatgcaggtg
tttgggaaaattgccttgaatgacacgacagagatcaaccggaacaacaactttcagacc
ttcccccaagctgtgctgctcctcttcaggtgtgccactggggaggcgtggcaggacatt
atgctggcctgcatgccagggaagaagtgcgccccggagtctgagccccacaacagcacg
gaaggggaggcgccctgtggcagcagcttcgccgtcttctacttcatcagcttctacatg
ctctgtgccttcctgattatcaacctctttgtagctgtcatcatggacaactttgactac
ctgacaagggactggtcaatccttggtccccaccatttggacgaatttaaaagaatctgg
gcagagtatgaccctgaggccaagggtcgtatcaaacacctggatgtggtgaccctgctc
cggcggattcagcccccactgggctttgggaagctgtgccctcaccgagtggcttgcaaa
cgtctggtctccatgaatatgcctctgaacagtgatgggacggtcatgttcaatgccacc
ctatttgccctggtccggacagccctgaggatcaaaacagaagggaacctggaacaagcc
aatgaggagctgcgggccataatcaagaagatctggaagcggaccagcatgaagctgctg
gaccaagtggtaccccccgcaggcgatgatgaggtcacggtcggcaagttttatgctact
ttcctgatccaagagtactttcggaaattcaagaagcgcaaagagcagggcctcgtgggc
aagccctcccagaggaacgccttgtccctacaggctggcttgcgcacgctgcacgacatc
gggcccgagatacgacgggccatctccggagacctgacagccgaggaggaactagacaaa
gccatgaaggaggctgtgtctgccgcctctgaagacgacatcttcaggagggctggtggc
ctgttcggcaaccacgtcagctactaccaaagcgacagccggagcaccttcccccagacc
ttcaccactcagcgcccgctgcacatcaacaaggccaccaacagcccaggcgacaccgag
tccccgtcccatgagaaactggtggactccaccttcacccccagcagctactcatccact
ggctccaatgccaacatcaacaacgccaacaacactgccctgggccgctttccccgcccc
acccgctaccccagctccgtcagcggcgctgtggagggccatgggccccccttgtctcct
gccatccgggtgcaggaggcagcgtggaagctcagctccaagaggtgccactcccgggag
agccagatagccatggtgtgtcgggaggagttttctcaggacgagacctatgacgtgcag
atgggtgacgacgcggagtactgcagtgagcccagcttggtctccacagacaagctctcc
taccaggatgaggaaagccgacagttggcaccgccagaggacaggagggacacccggcaa
tctccaaagaggggcttcctccgctcagcctccctgggtcggagggcctccttccacctc
gaatgtctgaagcgacagaagaatcaagggggagacatctctcagaagacagtcctgccc
ttgcatctggttcatcaccaggcattggcagtggcgggcctgagccccctcctccagaga
agccattctcccaccacgttcccccggccgtgtgccaccccgccggccacgcccagcagc
cgaggctggcccccgcagcccatccccaccctttggctggaaggaactgagtccaccgag
aaactcaacagcagcttcccatccgtccactgcagctcctgggcgggggagcccacagcc
tgcgaggggggcagcagcgccacacggagagcccggccggtgtccctcactgtgcccagc
caggccggggcctggggcaggcagttccacggcagtgccagcagtctggtggaagcagtc
ttgatttcggaaggactggggcagtttgcccaagatcccaagtttatcgaggtcacaacc
caggagctggctgacgcctgcgacatgaccatcgaggagatggagaacgctgcagacaac
atcctcagtgggggcgcccagcagagccccaacggcaccctattaccttttgttaactgc
agggaccaggggcaggacagagcagggggcgaggagcccgggccctgtgggcccagccag
gagcctcagaggagcgaggaggagctgcaggacagcagagcctacgtcagcagcctgtag

DBGET integrated database retrieval system