KEGG   Myotis davidii: 102754184Help
Entry
102754184         CDS       T02992                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
myd  Myotis davidii
Pathway
myd04146  Peroxisome
myd04213  Longevity regulating pathway - multiple species
myd05014  Amyotrophic lateral sclerosis (ALS)
myd05016  Huntington disease
myd05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:myd00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102754184 (SOD1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    102754184 (SOD1)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    102754184 (SOD1)
   05016 Huntington disease
    102754184 (SOD1)
   05020 Prion diseases
    102754184 (SOD1)
Enzymes [BR:myd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102754184 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 102754184
NCBI-ProteinID: XP_015415931
LinkDB All DBs
Position
Un
AA seq 213 aa AA seqDB search
AQKPSRGNRSVFTPSHGPALRVSRPVRSSWCRSAGLSLAWASWPGSWRRRQNQVTPTPVL
WGRADSVSPSLRTWPQPCASLWVQGNGKVKVSGSIRELTEGEHGFHVHQFGDNTQGCTSA
GPHFNPLSKSHGGPQDEERHVGDLGNVTAGPDGVANVLIEDSVIALSGEHSIIGRTLVVH
EKRDDLGKGGNDESKKTGNAGSRLACGVIGITQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
gcgcagaagccttccagagggaacaggagtgtcttcacgccctcgcacgggccggctctg
cgggtctccaggcccgttaggagctcttggtgccgttctgccggcctttccctggcctgg
gcttcttggccggggtcctggcgcaggcggcagaaccaggtcacccccacccccgtcctg
tggggtagagctgactcagtgtccccctccctcaggacatggcctcagccttgtgcttct
ctctgggtacagggaaacgggaaggtcaaggtctcgggctccatcagagagctgacggag
ggcgagcacggcttccatgtccaccagtttggagacaacacacaaggctgtaccagtgca
ggtcctcactttaaccctctgtccaagagccacggcgggccgcaggacgaagagaggcat
gtcggggacctgggcaacgtgacggcgggcccggacggtgtggccaacgtgctcattgag
gactctgtgattgcgctctcgggagagcattccatcatcggccgcacactagtggtccat
gagaagagagatgacctgggcaaaggtgggaatgacgaaagcaagaagacgggcaacgcc
gggagccgcctggcctgcggggtgatcggcatcacccagtga

DBGET integrated database retrieval system