KEGG   Myotis davidii: 102755037Help
Entry
102755037         CDS       T02992                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
myd  Myotis davidii
Pathway
myd00590  Arachidonic acid metabolism
myd01100  Metabolic pathways
myd04611  Platelet activation
myd04726  Serotonergic synapse
myd04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102755037 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102755037 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    102755037 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    102755037 (PTGS1)
Enzymes [BR:myd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102755037 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 102755037
NCBI-ProteinID: XP_015426135
LinkDB All DBs
Position
Un
AA seq 625 aa AA seqDB search
MGREGRARPARAPAELGAREVPAACISPGCAMNRWSLSSWFPLLLLLLPAGAREPSPVNP
CCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPDLWTWLRNSLRPSPSFTHCLLTH
GRWFWELINATFIRDMLMRLVLTARSNLIPSPPTYNVAHDYISWEAFSNLTYYTRVLPSV
PQDCPTPMGTKGKQQLPDPQLLSRRFLLRKKFIPDPQGANLMFAFFAQHFTHQFFKTSGK
MGAGFTKALGHGVDLGHIYGDNLDRQYQLRLFKDGKLKYQMLGGEMYPPSVEEAPVLMHY
PKGIPPKSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTARLI
LIGETIKIVIEEYVQQLSGYFLQLKFDPELLFSNQFQYQNRIALEFNHLYHWHPLMPDSF
TVGSQDYSYEQFLFNTSMLVDHGVEALVDAFSRQSAGRIGGGRNIDHHILHVAMDVIKES
REQRLQPFNEYRKRFGMKPYTSFQEFTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPN
SIFGESMIEIGAPFSLKGLLGNAICSPEYWKSSTFGGEMGFNIVKTATLKKLVCLNTKTC
PYVSFHVPDPLQDDEPGVERPSTEL
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgggtagggaggggcgggcccggccggccagagctcccgcggagttaggggcacgcgag
gttccggcagcttgcatctcgcccggctgcgccatgaaccgatggagtctttcgtcctgg
ttcccactgctcctgctgctgctgcccgcgggcgccagggagccctcgccggtgaacccc
tgttgctactacccatgccagcaccagggcatctgtgtccgctttggccttgaccgctac
cagtgtgactgcacccgcacgggctattctggccccaactgcaccatccctgacctgtgg
acctggctccggaattcattgcggcccagcccctctttcacccactgcctgctgacacac
gggcgctggttctgggagttaatcaatgccaccttcatccgtgacatgctcatgcgactg
gtactcacagcgcgttccaaccttattcccagcccccctacctacaacgtagcccatgat
tacatcagctgggaggccttctccaacttgacctattacactcgtgttctgccctctgtg
cctcaagactgccccacacccatggggaccaaaggaaagcagcagctgccagatccccag
ctcctgagccgtcgcttcctgctcaggaagaagttcatacctgacccgcaaggtgccaac
ctcatgtttgccttctttgcccaacacttcacccaccagttcttcaaaacttctggcaag
atgggtgctggcttcaccaaggccttgggccatggggtagaccttggccacatttatgga
gacaatctggaccgtcagtatcagctgcggctctttaaggatgggaaactcaagtaccag
atgctgggcggagagatgtacccgccatcggtggaagaggcgcctgtgttgatgcactac
ccaaagggcattccgcccaagagccagatggctgtgggccaggaggtgtttggactgctt
cccggactcatgctttatgccacgctctggctgcgcgaacacaaccgtgtgtgtgacctg
ctgaaggctgagcaccctacctggggagatgaacagctcttccagacggcccgcctcatc
ctcataggggagaccatcaagatcgtcatcgaggagtacgtgcagcagctgagtggctac
ttcctgcagctcaagttcgacccggagctgctgttcagcaaccagttccagtaccagaac
cgcatcgccttggagttcaaccatctctaccactggcacccgctcatgcccgactccttc
acggtgggctcccaggactacagctatgagcaattcctgtttaacacctccatgctggtg
gaccatggggtggaggccctggtggacgccttctctcgccagagcgctggccggattggt
gggggtaggaacatagatcaccatatcctgcatgtggccatggacgtcatcaaggaatct
cgagagcagcggctgcagcctttcaatgagtaccgcaagaggtttggcatgaagccctac
acctctttccaggagttcacaggagagaaggagatggcagctgaattggaggagctctat
ggagacattgatgccttggagttctacccgggactgcttcttgagaagtgccatccaaac
tccatctttggggagagtatgatagaaattggggctcccttttccctcaagggcctctta
gggaatgccatctgttctcctgagtactggaagtcaagcacatttggtggtgagatgggc
ttcaacattgttaagacggccacactgaagaagctggtttgcctcaacaccaagacgtgt
ccctatgtttccttccatgtacctgatcctctccaggatgatgagcctggtgtggagcgg
ccatccacagagctctga

DBGET integrated database retrieval system