KEGG   Myotis davidii: 102755288Help
Entry
102755288         CDS       T02992                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
myd  Myotis davidii
Pathway
myd00010  Glycolysis / Gluconeogenesis
myd00053  Ascorbate and aldarate metabolism
myd00071  Fatty acid degradation
myd00280  Valine, leucine and isoleucine degradation
myd00310  Lysine degradation
myd00330  Arginine and proline metabolism
myd00340  Histidine metabolism
myd00380  Tryptophan metabolism
myd00410  beta-Alanine metabolism
myd00561  Glycerolipid metabolism
myd00620  Pyruvate metabolism
myd01100  Metabolic pathways
Module
myd_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102755288 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    102755288 (ALDH2)
   00620 Pyruvate metabolism
    102755288 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102755288 (ALDH2)
   00561 Glycerolipid metabolism
    102755288 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102755288 (ALDH2)
   00310 Lysine degradation
    102755288 (ALDH2)
   00330 Arginine and proline metabolism
    102755288 (ALDH2)
   00340 Histidine metabolism
    102755288 (ALDH2)
   00380 Tryptophan metabolism
    102755288 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102755288 (ALDH2)
Enzymes [BR:myd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102755288 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 102755288
NCBI-ProteinID: XP_015422759
LinkDB All DBs
Position
Un
AA seq 465 aa AA seqDB search
MEIFINNEWHDAVSKKTFPTINPSTGEVICQVAEGDKEDVDRAVKAARAAFQLGSPWRRM
DASNTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTR
HEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPP
GVVNIIPGFGPTAGAAIASHKDVDKVAFTGSTEVGRLIQVAAGSSNLKRVTLELGGKSPN
IIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYAEFVERSVARAKSRVVGDPF
DSQTEQGPQVDETQFKKILGYINSGKKEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTI
AKEEIFGPVMQILKFKTIEEVVGRANNSMYGLAAAVFTKDLDKANYLSQALQAGTVWINC
YDVFGAQSPFGGYKMSGNGRELGEYGLKAYTEVKTVTVKVPQKNS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggagatcttcataaacaatgagtggcatgatgctgtcagcaagaagacgttccccacc
atcaatccctccacgggggaagtcatctgtcaggtagctgaaggggacaaggaagatgtg
gacagggcagtaaaggccgctcgggccgccttccagctgggctcgccctggcgccgcatg
gatgcctccaacacctacctggcggccttggagaccctggataatggcaagccctatgtc
atctcctacctggtggatttggacatggtcctcaaatgtcttcgttattatgccggctgg
gccgataagtaccatgggaaaaccattcccatcgatggggacttcttcagttacacccgc
cacgagcctgtgggtgtgtgcgggcagatcatcccgtggaactttccgctcctgatgcaa
gcgtggaaactgggccctgccttggcgactggaaacgtggttgtgatgaaggtggctgag
cagacgccactcaccgccctctacgtggccaacttgataaaggaggctggcttcccccct
ggcgtggttaatattattcctggatttggtcccacggctggggctgccattgcctcccac
aaggatgtggacaaagtggccttcacaggctccaccgaggttggccgcctaatccaggtc
gctgcggggagcagtaacctcaagcgggtgaccctggagctgggagggaagagccccaac
atcatcatgtccgatgctgacatggactgggccgtggagcaggcccacttcgccctgttc
ttcaaccagggccagtgctgctgtgcgggctcccggacctttgtgcaggaggatgtatat
gccgagtttgtggagcggagcgttgcccgggccaagtctcgggtggttggggaccccttt
gacagccagactgagcaggggccgcaggtggatgaaactcagtttaagaagatccttggc
tacatcaactctgggaagaaggagggggcgaagctgctgtgtggtggaggggcggccgct
gaccgcggctacttcatccagcccactgtgttcggagatgtgcaggatggcatgaccatc
gcaaaggaggagatctttgggccagtgatgcagatcctgaagtttaagaccatagaggaa
gtcgttgggagagcaaacaattccatgtatgggctggctgcagctgtcttcacaaaggac
ttggacaaagccaattatctgtcccaagcgctccaggctggcactgtgtggatcaactgc
tatgatgtgtttggggcccagtcaccgtttggtggctacaagatgtctgggaatggccgg
gagctgggagagtatggcctgaaggcatacactgaagtgaaaaccgtcacagtcaaagtt
cctcagaagaactcgtaa

DBGET integrated database retrieval system