KEGG   Myotis davidii: 102755932Help
Entry
102755932         CDS       T02992                                 

Gene name
SMYD1
Definition
(RefSeq) SET and MYND domain containing 1
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
myd  Myotis davidii
Pathway
myd00310  Lysine degradation
myd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102755932 (SMYD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:myd03036]
    102755932 (SMYD1)
Enzymes [BR:myd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     102755932 (SMYD1)
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     102755932 (SMYD1)
Chromosome and associated proteins [BR:myd03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102755932 (SMYD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-MYND
Motif
Other DBs
NCBI-GeneID: 102755932
NCBI-ProteinID: XP_006764038
LinkDB All DBs
Position
Un
AA seq 490 aa AA seqDB search
MTIGKMENVEVFTSEGKGRGLKATKEFWASDVIFAERAYSAVVFDSLVNFVCHTCFKRQE
KLHHCGQCKFARYCDRTCQKDAWVDHKKECLAVKRYGKVPNENIRLAARIMWRVEREGTG
LTEGCLVSVDDLQNHVENFGEEEQKQLRVDVDTFLQYWLPQSQQFSMQYISHIFGVINCN
GFTLSDQRGLQAVGVGIFPNLGLVNHDCWPNCTVIFNNGNHEAVKSMFHTQMRIELRALG
KISEGEELTVSYIDFLNVSEERKKQLKKQYYFDCTCEHCQKGLKDDLFLGVKDDPKPSQD
VVKEIIQFSKDTLEKIDKARSEGLYHEVVKLCRECLEKQDSVFADTNIYMLRVLSIVSEV
LSYLQAFEEASYYARRMVDGYVKLYHPNNAQLGMAVMRAGLTNWHAGNIEVGHGMICKAY
AILLVTHGPTHPITKDLEAMRMQTEMELRLFHQNEFMYRKMREAALNNQPMQVMAEPSSE
PAPSLFHKKQ
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgacaatagggaaaatggagaacgtggaggtcttcacttctgaaggcaagggcaggggc
ctgaaggccacgaaggagttctgggcttcggacgtcatctttgccgagcgggcttattct
gcagtggttttcgacagcctcgttaactttgtgtgccacacctgcttcaagaggcaggag
aagctccaccactgtgggcagtgcaagtttgcgcgttactgtgaccgcacctgccagaag
gatgcgtgggtagaccacaagaaggagtgcttggccgtcaagagatacgggaaggtgccc
aatgagaacatcaggctggctgcacgcatcatgtggcgggtggagagagagggcaccggg
ctcacggagggctgcctggtgtccgtggacgacctgcagaaccacgtggagaacttcggg
gaggaggagcagaagcagctgcgggtggacgtggatactttcttgcagtactggctgccc
cagagccagcagttcagcatgcagtacatctcccacatcttcggcgtgattaactgcaat
ggtttcacactcagtgaccagaggggcctgcaggcagtgggcgtgggcatcttccccaac
ctgggcctggtgaaccatgactgttggcccaactgcaccgtcatctttaacaacggcaat
catgaggcagtgaaatccatgtttcacacccagatgaggattgagctccgggccctgggc
aagatctcagaaggagaagagctgaccgtgtcctacatcgacttccttaacgtcagcgaa
gaacgcaagaagcagctgaagaagcagtactacttcgactgcacgtgcgagcattgccag
aaagggctgaaggacgacctcttcctgggggtgaaagatgacccaaagccctctcaggat
gtggtcaaggagattatacaattctccaaggatacactagaaaagattgacaaggctcgc
tctgagggcttgtaccacgaggttgtgaagttgtgccgggagtgcctggagaagcaggac
tccgtgtttgctgacaccaacatctacatgctgagggtgctgagcatcgtttccgaggtc
ctctcctacctccaggcgttcgaggaggcctcctactacgccaggaggatggtggatggc
tatgtgaagctctaccaccccaacaatgcccaactgggcatggccgtgatgcgggcgggg
ctgaccaactggcatgctggtaacattgaggtggggcacggtatgatctgcaaagcctat
gccattctcctggtgacacacggacccacccacccaattaccaaggacttagaggccatg
cggatgcagacggagatggagctgcgcctgttccaccagaacgagttcatgtaccgcaag
atgcgcgaggctgccctgaacaaccagcccatgcaggtcatggctgagcccagcagcgag
ccggcgccatctctgttccataagaagcaatga

DBGET integrated database retrieval system